SecReT4
Protein ID: 298736208
T4SS name [ID]Cag [34]
Gene symbolcagV
Locus tagHPB8_713
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]686072..686830 [+]
Productcag pathogenicity island protein V
Component typeCagV
UniProt IDD7FDL3
KEGG IDhpl:HPB8_713
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.8e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|298736208|ref|YP_003728734.1| cag pathogenicity island protein V [Helicobacter pylori B8]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALKQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|298735500|ref|NC_014256.1|:686072-686830 Helicobacter pylori B8 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAAGAAGTCTTGATTGATGAAAATTTGGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCTAAACTCAATAAGGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATGT
CGCCGCTGTAACGAGTATTGTAATGATGATGCCTTTGAAGAAAACGGATATATTTGTTTATGGCATTGAT
CGATACACAGGAGAATTTAAAATTGTCAAACGATCCGATGCTAGGCAAATTGTCAATTCTGAAGCTGTTG
TGGATAGTGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGTAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAATATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATCAAAATCACACCCGATACAATGGAAAATTATGA
ATATATTACTAAAAAACAAGTAACTATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAACCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACGGATTTACAAAACGAACAGACAGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAAACAATAA
 Primer design