SecReT4
Protein ID: 298736210
T4SS name [ID]Cag [34]
Gene symbolcagX
Locus tagHPB8_715
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]688486..690054 [+]
Productcag pathogenicity island protein X
Component typeCagX
UniProt IDD7FDL5
KEGG IDhpl:HPB8_715
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-38, Aligned region: 55..171
CagX [PF03524], Evalue: 2.4e-38, Aligned region: 257..347
CagX [PF03524], Evalue: 2.4e-38, Aligned region: 368..490
Protein Sequence: 522 a.a.     [Download]
>gi|298736210|ref|YP_003728736.1| cag pathogenicity island protein X [Helicobacter pylori B8]
MGQAFFKKIVGCFCLGYLFLSSAIEAAALDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLE
KDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKE
LEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSEFIKQQRENE
LDQMERLEDMQEQAQANALKQIEELNKKQAEEAVRQRAKDKINIKTDKSQKSPEDNSIELSPSDSAWRTN
LVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQKELIKQENLNTTAY
INRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIF
DDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNLGLRWYRVNEIAEKFKLIKDKALVTVINK
GYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|298735500|ref|NC_014256.1|:688486-690054 Helicobacter pylori B8 chromosome, complete genome
ATGGGGCAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGCAA
TAGAAGCAGCAGCACTTGACATTAAGAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGC
TTATTTGGGAGATGAAAAACCTATTACAATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTTGAA
AAAGATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTAATC
ATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCT
AATGACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCCGACCCTAAAGAA
TTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCGCAAAAAGCGCAAAAAG
ATAAAAGAGAAAAAAGAAAAGAAGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTAT
GAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTTATCAAGCAACAACGAGAAAATGAA
TTAGACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCGCTCAAACAAATTGAAG
AACTCAACAAGAAACAAGCTGAAGAGGCAGTTAGACAAAGAGCCAAGGATAAAATCAATATTAAGACAGA
TAAATCTCAAAAAAGTCCTGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGGACTAAT
CTTGTTGTGCGAACTAATAAAGCCTTGTATCAATTCATTTTGAGAATAGCTCAAAAAGACAATTTTGCTT
CGGCGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGAGGAGCT
AAAAAAGAGAGAAGAAGCAAAGAGGCAGAAAGAATTGATTAAGCAAGAAAATCTTAACACCACAGCCTAC
ATCAATAGAGTAATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAA
AAATTATCTTAGATCAAGCAAAGGCGCTAGAGACTCAATATGTGCATAATGCCTTAAAAAGAAACCCTGT
GCCTAGAAACTACAATTACTACCAAGCACCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTT
GATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAAC
CTGATGGGAAATTGAGCATGACTGATGCTGCCATTGATCCTAACATGACCAATTTAGGATTAAGATGGTA
TAGAGTTAATGAAATTGCAGAAAAATTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATAAATAAA
GGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGCGTGATTA
AAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design