SecReT4
Protein ID: 298736211
T4SS name [ID]Cag [34]
Gene symbolcagY
Locus tagHPB8_716
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]690069..695534 [+]
Productcag pathogenicity island protein Y
Component typeCagY
UniProt IDD7FDL6
KEGG IDhpl:HPB8_716
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 439..465
CagY_M [PF07337], Evalue: 0, Aligned region: 473..500
CagY_M [PF07337], Evalue: 0, Aligned region: 510..538
CagY_M [PF07337], Evalue: 0, Aligned region: 552..584
CagY_M [PF07337], Evalue: 0, Aligned region: 585..615
CagY_M [PF07337], Evalue: 0, Aligned region: 621..653
CagY_M [PF07337], Evalue: 0, Aligned region: 655..678
CagY_M [PF07337], Evalue: 0, Aligned region: 690..722
CagY_M [PF07337], Evalue: 0, Aligned region: 729..761
CagY_M [PF07337], Evalue: 0, Aligned region: 768..800
CagY_M [PF07337], Evalue: 0, Aligned region: 806..838
CagY_M [PF07337], Evalue: 0, Aligned region: 839..867
CagY_M [PF07337], Evalue: 0, Aligned region: 875..907
CagY_M [PF07337], Evalue: 0, Aligned region: 913..945
CagY_M [PF07337], Evalue: 0, Aligned region: 952..984
CagY_M [PF07337], Evalue: 0, Aligned region: 990..1022
CagY_M [PF07337], Evalue: 0, Aligned region: 1023..1051
CagY_M [PF07337], Evalue: 0, Aligned region: 1059..1091
CagY_M [PF07337], Evalue: 0, Aligned region: 1097..1129
CagY_M [PF07337], Evalue: 0, Aligned region: 1136..1167
CagY_M [PF07337], Evalue: 0, Aligned region: 1170..1195
CagY_M [PF07337], Evalue: 0, Aligned region: 1205..1237
CagY_M [PF07337], Evalue: 0, Aligned region: 1244..1275
CagY_M [PF07337], Evalue: 0, Aligned region: 1283..1317
CagY_M [PF07337], Evalue: 0, Aligned region: 1322..1349
CagY_M [PF07337], Evalue: 0, Aligned region: 1371..1405
TrbI [PF03743], Evalue: 5.4e-36, Aligned region: 1585..1781
Protein Sequence: 1821 a.a.     [Download]
>gi|298736211|ref|YP_003728737.1| cag pathogenicity island protein Y [Helicobacter pylori B8]
MNEENDKLETSKKIQQHSPQDLSNEEATEANHFEDSSKESKESSDHHLNNPTETKTNFDGDKSEETQTQM
DSGGDETSESSNGSLADKLFKKARKLVDNKRLFTQQKNLDEETQELNEEDDQENNGYQEETQTGLIDDET
SKKTQQHSPQDLSNEEATEINHFEDSSKESKESSDPYLDNPTETKTNFDEDKSEETQTQMDSGGDETSES
SNGSLADKLFKKARKLVDNKRLFTQQKNLDEETQELNEEDDQENNGYQEETQTGLIDDETSKKTQQHSPQ
DLSNEEATEINHFEDSSKESKESSDPYLDNPTETKTNFDEDKSEEITNDSNDQEIIKGSKKKYIIGGIVV
AVLIVIILFSRSIFHYFMPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLFFNDDPN
RTLYNYLNIAEIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYNDCIKNAKTEEERIKC
LDLIKDENLKKSLLNQQKVQVALDCLKNAKTDEERKECLKLINDPEIREKFRKELELQKELQEYKDCIKN
AKTEAEKNECLKGLSKEAIERLKQQALDCLKNAKTDEERNECLKNIPQDLQKELLADMSVKAYKDCVSKA
RNEKEKQECEKLLTPEARKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESVKAYKDCVSQAK
NEAEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKLLEEEAKESVKAY
LDCVSQAKTEAEKKECEKLLTPEARKKLEEAKKSVKAYKDCVSQAKNEDEKKECEKLLTPEARKLLEQQA
LDCLKNAKTDEERKKCLKDLPKDLQKKVLAKESVKAYLDCVSQAKNEAEKKECEKLLTPEARKLLEEAKE
SIKAYKDCVSKARNEKEKKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKK
LLEEAKESLKAYKDCVSRARNEKEKKECEKLLTPEAKKLLEQQALDCLKNAKTEADKKRCVKDLPKDLQK
KVLAKESVKAYKDCVSRARNEKEKKECEKLLTPEAKKLLEEAKESLKAYKDCLSQARNEEERRACEKLLT
PEARKLLEQEVKKSVKAYLDCVSQAKTEAEKKECEKLLTPEARKFLAKQVLNCLEKAGNEEERKACLKNL
PKDLQENVLAKESLKAYKDCLSQARNEEERRACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKK
ECEKLLTPEARKFLAKELQQKDKAIKDCLKNADPNDRAAIMKCLDGLSDEEKLKYLQEAREKAVLDCLKT
ARTDEEKRKCQNLYSDLIQEIQNKRTQSKQNQLSKTERLHQASECLDNLDDPTDQQAIEQCLEGLSDSER
ALILGIKRQADEVDRIYSDLRNRKTFDNMAAKGYPLLPMDFKNGGDIATINATNVDADKIASDNPIYASI
EPDITKQYETEKTIKDKNLEAKLAKALGGNKKDDDKEKSKKSTAEAKVESNKIDKDVAETAKNISEIALK
NKKEKNGEFVDENGNPIDDKKKAEKQDETSPVKQAFIGKSDPTFVLAQYTPIEITLTSKVDATLTGIVSG
VVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMTRLMIVFTKAITPDGVIIPLANAQAAGMLGEAGV
DGYVNNHFMKRIGFAVIASVVNSFLQTAPIIALDKLIGLGKGRSERTPEFNYALGQAINGSMQSSAQMSN
QILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDVKITNKSVVDEIIKQSTKTLSREHEEITTSPKGG
N
 
Nucleotide Sequence: 5466 bp     [Download]
>gi|298735500|ref|NC_014256.1|:690069-695534 Helicobacter pylori B8 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAATCCAACAACATTCACCCCAAGATTTATCCA
ATGAAGAAGCAACAGAAGCCAATCATTTTGAAGATTCTTCAAAAGAATCCAAAGAAAGCTCAGATCATCA
TCTTAACAACCCTACAGAAACTAAAACCAATTTTGATGGAGACAAGTCAGAAGAAACCCAAACTCAAATG
GATTCTGGTGGTGATGAAACTTCAGAATCTAGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCA
GAAAATTAGTTGATAATAAAAGACTTTTCACTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAACTGAA
CGAAGAAGACGATCAAGAAAATAATGGGTATCAAGAAGAAACTCAAACGGGCTTAATTGATGATGAAACT
TCTAAAAAAACCCAACAACATTCACCCCAAGATTTATCCAATGAAGAAGCAACAGAGATCAATCACTTTG
AAGATTCTTCAAAAGAATCCAAAGAAAGCTCAGATCCTTATCTTGATAACCCCACAGAAACTAAAACCAA
TTTTGATGAAGACAAGTCAGAAGAAACCCAAACTCAAATGGATTCTGGTGGTGATGAAACTTCAGAATCT
AGCAATGGCAGTCTAGCAGACAAGTTATTCAAAAAAGCCAGAAAATTAGTTGATAATAAAAGACTTTTCA
CTCAGCAAAAGAATTTAGATGAAGAAACCCAAGAACTGAACGAAGAAGACGATCAAGAAAATAATGGGTA
TCAAGAAGAAACTCAAACGGGCTTAATTGATGATGAAACTTCTAAAAAAACCCAACAACATTCACCCCAA
GATTTATCCAATGAAGAAGCAACAGAGATCAATCACTTTGAAGATTCTTCAAAAGAATCCAAAGAAAGCT
CAGATCCTTATCTTGATAACCCCACAGAAACTAAAACCAATTTTGATGAAGACAAGTCAGAAGAAATAAC
TAACGACTCTAACGATCAAGAAATTATCAAAGGAAGCAAAAAGAAATATATTATTGGTGGCATTGTAGTC
GCTGTTCTTATCGTGATTATTTTATTTTCTAGAAGCATTTTTCACTACTTCATGCCTTTGGAAGATAAAA
GCTCTCGTTTTAGCAAAGACAGGAATCTTTATGTTAATGATGAAATCCAAATAAGGCAAGAGTATAACCG
ATTGCTGAAAGAACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTCTTCAATGACGATCCCAAT
AGAACCTTATACAACTATTTAAATATTGCAGAAATTGAGGACAAAAACCCGTTGAGAGCCTTTTATGAAT
GTATTAGTAATGGTGGCAACTATGAAGAATGTTTGAAGCTTATCAAAGACAAAAAACTTCAAGATCAGAT
GAAAAAGACTCTAGAGGCTTATAATGACTGCATCAAAAATGCCAAAACTGAAGAAGAAAGGATCAAGTGT
TTAGATTTAATCAAAGATGAAAACCTGAAAAAAAGCTTACTGAACCAACAAAAAGTTCAAGTGGCGCTAG
ATTGTTTGAAAAACGCTAAAACTGATGAAGAACGGAAAGAGTGCCTAAAACTCATAAATGACCCTGAGAT
TAGAGAGAAATTCCGTAAGGAATTAGAGCTTCAAAAAGAGCTTCAAGAGTATAAGGATTGTATCAAAAAC
GCCAAAACAGAAGCTGAGAAAAACGAATGCTTGAAAGGCTTGTCTAAAGAAGCTATAGAAAGATTGAAAC
AGCAAGCGCTAGATTGTTTGAAAAACGCTAAAACTGATGAAGAACGAAACGAGTGCTTGAAAAATATTCC
CCAAGACTTGCAAAAAGAACTACTAGCTGATATGAGCGTCAAGGCTTACAAGGATTGCGTATCAAAAGCT
AGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGGAAAAAGTTAGAACAAC
AGGTTCTAGATTGTTTGAAAAACGCTAAAACTGATGAAGAACGAAAAAAATGTTTGAAAGATCTCCCTAA
AGACTTACAAAGCGATATTTTAGCTAAAGAGAGCGTTAAAGCTTATAAAGATTGCGTATCTCAAGCCAAA
AACGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAAG
CCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGAAGCCGAGAAAAAAGAATG
CGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAAGCCAAAGAGAGCGTTAAGGCTTAT
TTGGATTGCGTATCTCAAGCCAAAACTGAAGCCGAGAAAAAAGAGTGTGAGAAATTACTCACCCCTGAAG
CGAGAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAAGCTTATAAAGATTGCGTATCTCAAGCCAAAAA
CGAAGATGAGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAGAAAACTTTTAGAGCAACAAGCG
TTAGATTGTTTGAAAAATGCTAAAACCGATGAAGAACGAAAAAAGTGTTTGAAAGATCTCCCTAAAGACT
TGCAGAAAAAGGTTTTAGCCAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAAGCCAAAAACGA
AGCTGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAGAAAACTCTTAGAAGAGGCTAAAGAG
AGCATTAAAGCTTATAAAGACTGCGTATCAAAAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAAT
TGCTCACCCCTGAAGCGAAAAAACTTTTAGAAGAAGAAGCCAAAGAGAGCGTTAAGGCTTATTTGGATTG
CGTATCTCAAGCCAAAACTGAAGCCGAGAAAAAAGAGTGTGAGAAATTACTCACCCCTGAAGCGAAAAAA
CTTTTAGAAGAAGCTAAAGAGAGCCTTAAAGCTTATAAAGACTGCGTATCAAGAGCTAGGAATGAAAAAG
AGAAAAAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAAAAAACTTTTAGAACAACAAGCGCTAGATTG
TTTGAAAAACGCTAAAACCGAAGCTGATAAAAAAAGGTGTGTCAAAGATCTCCCTAAAGACCTGCAGAAA
AAGGTTTTAGCTAAAGAGAGCGTTAAAGCTTATAAAGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGA
AAAAGGAATGCGAGAAATTACTCACCCCTGAAGCGAAAAAACTTTTAGAAGAAGCTAAAGAGAGTCTTAA
AGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAACTACTCACG
CCTGAAGCGAGGAAACTCTTAGAGCAAGAAGTTAAGAAGAGCGTTAAGGCTTATTTGGATTGCGTATCTC
AAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAAGTTCTTAGC
GAAGCAAGTGCTAAATTGTTTGGAAAAAGCTGGAAATGAAGAAGAAAGAAAAGCATGTCTTAAAAATCTC
CCTAAAGACTTACAGGAAAATGTTTTAGCTAAAGAGAGTCTTAAAGCTTATAAAGACTGCCTCTCTCAAG
CTAGAAATGAAGAAGAAAGGAGAGCTTGCGAGAAATTACTCACCCCTGAAGCGAGAAAACTCTTAGAGCA
AGAAGTTAAGAAGAGCGTTAAGGCTTATTTGGACTGCGTATCAAGAGCTAGGAATGAAAAAGAGAAAAAA
GAATGCGAGAAATTGCTCACCCCTGAAGCGAGGAAATTTTTAGCGAAAGAACTCCAACAAAAAGATAAAG
CGATCAAAGATTGCTTGAAAAACGCCGATCCTAACGACAGAGCGGCTATCATGAAGTGTTTGGATGGTTT
GAGCGATGAAGAGAAGCTCAAATACCTGCAAGAAGCTAGAGAAAAGGCTGTCTTGGATTGTTTGAAAACG
GCTAGGACCGATGAAGAAAAAAGGAAATGCCAAAACCTTTATAGCGATTTGATCCAAGAAATCCAAAATA
AAAGGACACAAAGCAAACAAAATCAATTGAGTAAAACAGAAAGATTGCATCAAGCAAGCGAGTGCTTGGA
TAACTTAGATGACCCTACTGATCAACAAGCCATAGAGCAATGTTTAGAGGGCTTGAGCGATAGTGAAAGG
GCGCTAATTCTAGGAATTAAACGACAAGCTGATGAAGTGGATCGGATTTATAGCGATCTAAGAAACCGCA
AAACCTTTGATAACATGGCGGCTAAAGGTTATCCGTTGTTGCCAATGGATTTCAAAAATGGCGGCGATAT
TGCCACTATTAACGCCACTAATGTTGATGCGGACAAAATAGCTAGCGATAATCCTATTTATGCTTCCATA
GAGCCCGACATTACCAAACAATACGAAACAGAAAAAACCATTAAGGATAAGAATTTAGAAGCTAAATTAG
CTAAGGCTTTAGGTGGCAATAAAAAAGATGACGATAAAGAAAAAAGTAAAAAATCCACAGCAGAAGCTAA
AGTAGAAAGCAATAAGATAGACAAAGATGTCGCAGAAACTGCTAAGAATATCAGTGAAATCGCTCTTAAG
AACAAAAAAGAAAAGAATGGGGAATTTGTAGATGAAAATGGTAATCCCATTGATGACAAAAAGAAAGCAG
AAAAACAAGATGAAACAAGCCCTGTCAAACAGGCCTTTATAGGCAAGAGTGATCCCACATTTGTTTTAGC
GCAATACACCCCCATTGAAATCACTCTGACTTCTAAAGTAGATGCCACTCTCACAGGTATAGTGAGTGGG
GTTGTAGCCAAAGATGTATGGAACATGAACGGCACTATGATCTTACTAGATAAAGGCACTAAGGTGTATG
GGAATTATCAAAGCGTGAAAGGTGGCACACCTATTATGACACGCTTAATGATAGTCTTTACTAAAGCCAT
TACGCCTGATGGTGTGATAATACCTCTAGCAAACGCTCAAGCAGCAGGCATGTTGGGTGAAGCAGGGGTA
GATGGCTATGTGAATAATCACTTTATGAAGCGCATAGGCTTTGCTGTGATAGCAAGCGTGGTTAATAGCT
TCTTGCAAACTGCGCCTATCATAGCTCTAGATAAACTCATAGGTCTTGGCAAAGGTAGAAGTGAAAGGAC
ACCTGAATTTAATTACGCTTTGGGTCAAGCTATCAATGGTAGTATGCAAAGTTCAGCCCAGATGTCTAAT
CAAATTCTAGGGCAACTGATGAATATCCCCCCAAGTTTTTACAAAAATGAGGGCGATAGTATTAAGATTC
TCACAATGGACGATATTGATTTTAGTGGCGTGTATGATGTTAAAATTACCAACAAATCTGTGGTAGATGA
AATTATCAAACAAAGCACTAAAACTTTGTCTAGAGAACATGAAGAAATCACCACAAGCCCCAAAGGTGGC
AATTAA
 Primer design