SecReT4
Protein ID: 298736214
T4SS name [ID]Cag [34]
Gene symbolcag5
Locus tagHPB8_719
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]697288..699534 [+]
Productcag pathogenicity island protein beta
Component typeCagbeta
UniProt IDD7FDL9
KEGG IDhpl:HPB8_719
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.9e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 7.2e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.6e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|298736214|ref|YP_003728740.1| cag pathogenicity island protein beta [Helicobacter pylori B8]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKSFKEIIIDGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRSPESDDDLFDIWIYAIQDFPAYYFKALCFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRTF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRVLNPATRNMWNNFKTMGGAKETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGRNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|298735500|ref|NC_014256.1|:697288-699534 Helicobacter pylori B8 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTTCTTTACAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAACCAGCCTCAAAAGAAAAAAAGCTTTAAAGAAATCATTATAGATGGGCTGAAAGAAAGGGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGATTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGATGATAATCGATCGCCTGAGAGCGATGATGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCGCTTTGTTTTAGTTCACTCAAAATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGATATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGTAGCGC
GAGTTGGGAAACTGAAGAGAAAATGATCAAAGCCAAGCTCATCACGCCCAACAATAAAAAACGCACCTTT
GACAAACGAGAGGTGATTGTAGGCAGGCGTGGCTTGGGGGATTTTATCGCTTACGCAGGGCAGGCGTTCA
TTGGCTTGATTGCTCCTACTAGAAGCGGTAAGGGGGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAAGCTGACACTATGGAGACTTGCGGAAAAATCAGAGAAAAACGC
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGGATGGTGGCTAGTGGGGGGGATTTTTCCACTCAAATCTTTGGATTGGCTAAGCTCGTGTTCCCTGAA
AGACCCAATGAAAAAGATCCTTTTTTTAGCAATCAAGCGCGAAATCTCTTTGTCATCAATTGCAATATTT
ATAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCCACGATGTTTTTCATAGGTTCTATGGCAAGCGGTATCAATTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTCTGATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGACAATCTAAGAGTGCTTA
ATCCTGCTACTAGAAACATGTGGAACAACTTTAAGACAATGGGTGGCGCTAAAGAAACTTACAGCTCTGT
TCAAGGGGTCTATACATCAGCGTTTGCGCCTTACAATAACGCTATGATCAGGAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTAAGGATTGATGAGGTCAGCATTGGCGTGATCGCTAACCCCAAAGAAAGCA
CTATTGTTGGGCCGATACTAGAGCTGTTTTTTAATGTGATGATTTATAGCAATCTTATTCTGCCAATCCA
TGATCCACAATGCAAAAGAAGTTGCTTAATGCTTATGGATGAATTCACGCTCTGTGGCTATTTAGAGACC
TTTGTTAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCCGCTTTTGTGTTTCAAAGTAAGGCGC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAGGAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
GAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTATTAGGG
AAATACACAAGGCAAGACGTGAGCCGAAGCATTGATGATAATACAGGTAAGACCAACACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACTATGGGCGATGAGCTTATCATTCTAGAGAA
TACGCTCAAACCTATCAAGTGCCACAAGGCGCTTTACTATGATGATCCATTCTTCACCGATGAACTCATT
AAGGTAAGTCCAAGCTTGAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACTTTCTATGATG
ATTTGCAAGCCGCTAAAACTAGAGGTGAATTGAGTTATGATAAATCTTTAGTGCCTGTGGGTTCAAGCGA
ACTGTGA
 Primer design