SecReT4
Protein ID: 298736218
T4SS name [ID]Cag [34]
Gene symbolcag3
Locus tagHPB8_723
StrainHelicobacter pylori B8
Repliconchromosome [GenBank: NC_014256] [Browse all T4SS(s) in this replicon]
Location [Strand]700533..701978 [-]
Productcag pathogenicity island protein delta
Component typeCagdelta
UniProt IDD7FDM3
KEGG IDhpl:HPB8_723
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|298736218|ref|YP_003728744.1| cag pathogenicity island protein delta [Helicobacter pylori B8]
MFRKLATAVSLIGLLISNTLYAKEISEADKVIKATKETKETKKEAKRLKKEARQRQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINENMPYAQATFLRVPKRSDPNAHTLDKGAAIDENKLFEQQKKM
YFNYANDVICRPDDEVCSPLRDEMVAMPTSDSVTQKPNIIAPYSLYRLKETNNANETQPSPYATQTAPES
SKEKLIEELIANSQLIANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPISPQTSNSDETMRVVKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKTPLNPNDLRSLEEEIKSYY
IKSNGLCYANGISLYAKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|298735500|ref|NC_014256.1|:c701978-700533 Helicobacter pylori B8 chromosome, complete genome
ATGTTTAGAAAACTGGCAACCGCTGTATCGCTCATAGGCTTACTAATCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTTATTAAAGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAGACAGCGCCAACAGATCCCTGATCATAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGCTGTTTGATATATACGACACCTTGAATGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTGTTGGATTATAACAATTA
CTTATCCATAGAAAATCCCATTATCAAAACAAGAGCGATGGGAACTTATGCGGATTTGATTATCATCACA
GGCTCATTAGAGCAAGTCAATGGGTATTACAACATTCTAAAAGCGCTCAACAAACGCAACGCTAAGTTTG
TGTTAAAAATCAATGAGAACATGCCTTATGCCCAAGCGACTTTTTTAAGAGTGCCAAAAAGAAGCGATCC
TAATGCCCACACGCTTGATAAGGGAGCGGCAATTGATGAGAATAAGCTTTTTGAACAACAAAAGAAAATG
TATTTCAATTACGCTAACGATGTGATCTGCAGACCCGATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTAGCTATGCCCACTAGCGATAGCGTTACTCAAAAGCCCAATATCATTGCTCCTTATAGCTTGTATAG
ACTCAAAGAGACAAATAACGCCAATGAGACCCAACCATCACCTTATGCCACCCAAACCGCTCCTGAAAGC
AGCAAAGAGAAGCTTATAGAAGAGCTAATCGCTAACTCCCAACTCATAGCCAATGAGGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAACGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTTCTCCTCAAACAAGTAATTCTGATGAAACAATGAGAGTTGTCAAAGAAAAAGAGAACTATA
ATGGGTTATTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAAACACCTCTCAACCCTAATGACTTGAGGAGCCTAGAAGAAGAAATTAAGAGCTACTAT
ATCAAGTCTAATGGCTTGTGTTACGCTAATGGCATCAGTCTCTATGCAAAAATCAAAAACGACCCCTATA
AAGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAATCTGCTCTCACCTTTAAAGGACAAGCTCAAATA
CGACAAGCAAAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design