SecReT4
Protein ID: 300713321
T4SS name [ID]Tra_F [124]
Gene symboltraL
Locus tagEbC_pEb17201890
StrainErwinia billingiae Eb661
Repliconplasmid pEB170 [GenBank: NC_014305] [Browse all T4SS(s) in this replicon]
Location [Strand]137024..137326 [+]
Productconjugal transfer pilus assembly protein
Component typeTraL_F
UniProt IDD8MK44
KEGG IDebi:EbC_pEb17201890
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.8e-29, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|300713321|ref|YP_003739360.1| conjugal transfer pilus assembly protein [Erwinia billingiae Eb661]
MDSDALKYRFPETLNGQKRVFGLPPEEAFVLVGCGVIGFFCDIFIIMLCVGAVLWLFVRHLKKGQGSWWL
LNLLYWYLPTVLFRVQFRRTPDSGNRHWMQ
 
Nucleotide Sequence: 303 bp     [Download]
>gi|300713132|ref|NC_014305.1|:137024-137326 Erwinia billingiae Eb661 plasmid pEB170, complete sequence
ATGGACAGCGACGCGCTTAAATACCGGTTCCCGGAAACGCTTAACGGCCAGAAACGCGTGTTCGGCCTCC
CGCCCGAGGAGGCTTTCGTTCTCGTCGGCTGCGGCGTCATCGGCTTCTTCTGCGACATATTCATCATCAT
GCTCTGCGTGGGGGCCGTGCTCTGGCTCTTCGTCAGGCACCTGAAGAAAGGGCAGGGGTCCTGGTGGCTG
CTGAACCTTCTTTACTGGTACCTGCCGACGGTGCTTTTCCGGGTGCAGTTCAGGCGGACGCCCGACTCGG
GCAACCGGCACTGGATGCAGTAG
 Primer design