SecReT4
Protein ID: 300713338
T4SS name [ID]Tra_F [124]
Gene symboltraF
Locus tagEbC_pEb17202060
StrainErwinia billingiae Eb661
Repliconplasmid pEB170 [GenBank: NC_014305] [Browse all T4SS(s) in this replicon]
Location [Strand]150567..151364 [+]
Productconjugal pilus assembly protein
Component typeTraF_F
UniProt IDD8MK61
KEGG IDebi:EbC_pEb17202060
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-77, Aligned region: 37..255
Protein Sequence: 265 a.a.     [Download]
>gi|300713338|ref|YP_003739377.1| conjugal pilus assembly protein [Erwinia billingiae Eb661]
MMRALLLAAVMACALPAFADGPPPADEVVDPADPFTGWHWYNEPKKKAETPAPKPRPTQQVPDFSRLSPG
EQADVLKGYTKEALNNAILHPSAENTATFLRWQKFWTDRASMFSQSFAVAQLHHPDLDYNLEHPHYNSTA
PLQQARDQADQTQAIAQLAGQYGLVYFYRGGDPIDAQMAGVVADFARTRHVALIPVSMDGQVSPQVPDSR
PDGGQSARMGISHYPALFLVDPASKDYRPLAYGFMTQDDLAKRFLNVATGFKPNF
 
Nucleotide Sequence: 798 bp     [Download]
>gi|300713132|ref|NC_014305.1|:150567-151364 Erwinia billingiae Eb661 plasmid pEB170, complete sequence
ATGATGAGAGCACTGTTACTGGCCGCCGTGATGGCGTGTGCGCTGCCGGCGTTTGCGGACGGGCCGCCGC
CGGCGGATGAGGTGGTGGATCCGGCCGACCCGTTCACCGGCTGGCACTGGTACAACGAGCCGAAGAAAAA
GGCGGAAACGCCCGCGCCGAAGCCCCGGCCCACACAGCAGGTGCCGGACTTCAGCCGGTTGTCACCCGGC
GAGCAGGCCGACGTGCTGAAGGGCTACACGAAGGAGGCGCTGAACAACGCCATCCTGCACCCGTCGGCGG
AGAACACGGCGACGTTCCTGCGCTGGCAGAAGTTCTGGACCGACCGGGCCTCGATGTTCAGCCAGTCGTT
CGCGGTGGCGCAGCTGCATCATCCGGACCTCGATTACAACCTCGAGCATCCGCACTACAACAGCACCGCG
CCGCTGCAGCAGGCCCGCGACCAGGCGGACCAGACGCAGGCCATCGCGCAGCTCGCCGGCCAGTACGGGC
TGGTGTACTTCTACCGCGGCGGCGACCCGATTGATGCGCAGATGGCGGGCGTGGTGGCGGACTTTGCGCG
TACCCGTCACGTCGCGCTCATCCCGGTCAGCATGGACGGTCAGGTTTCACCGCAGGTGCCGGACAGCCGG
CCCGACGGCGGGCAGAGCGCGCGGATGGGCATCAGCCACTATCCGGCCCTGTTTCTGGTCGACCCGGCAT
CAAAAGACTACCGCCCGCTGGCCTACGGCTTTATGACGCAGGACGACCTGGCGAAGCGGTTCCTCAACGT
GGCCACCGGCTTTAAGCCGAACTTTTAA
 Primer design