SecReT4
Protein ID: 300724372
T4SS name [ID]Tfc [695]
Gene symbol-
Locus tagXNC1_3549
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3425009..3425767 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDD3VA20
KEGG IDxne:XNC1_3549
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.2e-73, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|300724372|ref|YP_003713690.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MAQSENQSRPSSQPPRKHGLLYRLLWEWPWQLIGFMVMSWLFSLLLEYLGMAFFWPEQGATHSQNMMKTE
LNYLSSEFTRSLLLSEPSQTVSAWLAQVYQWLFVDSGFMGWVQRQSQYQFNSRNDFMREFNAVLQGISGH
LREYWLATVFITMVTLIRLAILLLSVPLFVMVLLVALVDGLGRRDLRRYGAGYESSFVYHHAKRGIKPAC
TVPCVLYLSWPGVVYPTVILLPAAIVLGMAVVITVSMFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3425009-3425767 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGCACAGTCAGAAAACCAGTCCCGCCCATCTTCCCAACCGCCCCGCAAGCATGGCCTGCTTTATCGTC
TGTTATGGGAATGGCCGTGGCAACTCATTGGGTTTATGGTGATGTCCTGGCTATTCAGCCTGTTACTGGA
ATATCTTGGTATGGCTTTTTTCTGGCCGGAACAGGGTGCCACTCACAGTCAGAATATGATGAAGACAGAG
CTTAACTATCTCTCCTCAGAATTTACCCGAAGCCTGTTGCTGTCAGAACCCTCACAAACCGTTTCGGCAT
GGCTGGCACAGGTTTATCAGTGGCTGTTTGTAGACAGTGGTTTTATGGGCTGGGTTCAGAGACAGTCGCA
ATACCAGTTCAATAGCCGCAATGATTTTATGCGTGAATTCAATGCGGTATTACAGGGTATATCGGGGCAT
TTGCGGGAGTATTGGCTGGCCACGGTATTTATCACGATGGTGACGCTGATCCGGCTGGCAATTTTGTTGT
TATCTGTACCCTTGTTTGTGATGGTGCTTTTAGTCGCATTGGTCGATGGATTAGGACGGCGGGATTTGCG
GCGTTATGGGGCAGGGTATGAATCCAGTTTTGTTTACCATCATGCCAAACGGGGGATTAAACCGGCCTGC
ACGGTTCCCTGTGTACTGTATTTATCGTGGCCGGGTGTGGTGTATCCTACCGTGATATTGTTGCCGGCGG
CGATAGTGCTGGGCATGGCGGTCGTGATAACGGTCTCAATGTTTAAAAAATATCTTTGA
 Primer design