SecReT4
Protein ID: 300724375
T4SS name [ID]Tfc [695]
Gene symbol-
Locus tagXNC1_3553
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3427783..3428112 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD3VA23
KEGG IDxne:XNC1_3553
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2e-21, Aligned region: 24..103
Protein Sequence: 109 a.a.     [Download]
>gi|300724375|ref|YP_003713693.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MRGDFSLSRSACLLSLILMCIPLAQAAEKDELASAKNLIDQVQMALERASLAEKQADTPTRPRYNFDYLR
IKADLSTIKAGIDHYLTPSRAQQQGSGVLSGHYRQEHPQ
 
Nucleotide Sequence: 330 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3427783-3428112 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCGAGGTGACTTTTCTTTGTCCCGTTCTGCCTGTCTGCTGAGTCTGATACTGATGTGTATACCGCTTG
CGCAGGCGGCCGAGAAAGATGAACTGGCGAGTGCAAAAAATCTGATTGATCAGGTGCAGATGGCACTGGA
GCGTGCAAGCCTCGCTGAAAAGCAGGCAGACACCCCAACCCGCCCTCGCTATAACTTTGATTACCTTCGT
ATCAAAGCGGATCTCAGCACCATCAAAGCCGGTATTGATCACTACCTGACCCCTTCCCGTGCCCAGCAGC
AGGGATCAGGCGTGCTATCCGGTCATTACCGTCAGGAGCATCCGCAATGA
 Primer design