SecReT4
Protein ID: 300724396
T4SS name [ID]Tfc [695]
Gene symbol-
Locus tagXNC1_3574
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3455978..3457417 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDD3VA44
KEGG IDxne:XNC1_3574
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 479 a.a.     [Download]
>gi|300724396|ref|YP_003713714.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MIRKPGLLMVGGLALATAQVQASERSVSLPAVSHSALGYGAQSSGAVSDTLFYTLGGGPVISEPASRGGS
TRLAGLELGWRSDLMCGNFDLKTTVSNQLNGITAGMKNLMSEVIQGATGAVASLPAMIIQRANPGLYDML
TNGVLQANVAFDKAQFNCQNMARRMGDFAQNNKWSQSASLQEYKNQVNGGDADAVRANNAGTRATGTGGH
PWIGGRKQGGKGQSAIRPTRDLASAGFNMMNHQPVLSTAAIRHQDCSGSSCTKFSSAREAAEAVVNVLGD
RAIRTCANAAECISGGEAHQPGTTVAGTGFAPMLEAQTQANMEQLVKLVNGTEKPTAPNLAKLKTGSLTI
TRGVIQALQRDPDNAALTARLAGELAMAETTETALLMRRMLITGMSEPNAAAQAEALNEGERRIAALDRE
ITALKNEMTLKQELARNSILTIIARENHRIEAHPQKHVTESSDKRFYQLENPANRVTGR
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3455978-3457417 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGATAAGAAAACCGGGACTGCTGATGGTGGGCGGGCTGGCACTCGCTACCGCTCAGGTTCAGGCATCAG
AACGGTCGGTTTCCTTACCGGCCGTCAGTCACAGTGCACTGGGCTATGGTGCACAGAGCAGCGGGGCAGT
CTCCGATACGCTGTTCTATACCCTCGGTGGCGGCCCGGTGATTTCTGAGCCGGCCAGCCGTGGAGGTTCA
ACCAGGCTGGCCGGGCTGGAGCTGGGCTGGCGTTCGGATTTGATGTGCGGCAATTTTGACCTGAAAACCA
CGGTCAGTAATCAGCTCAACGGTATCACGGCGGGCATGAAAAACCTGATGAGTGAAGTCATCCAGGGCGC
CACCGGGGCGGTGGCCAGTCTCCCCGCCATGATAATCCAGCGGGCCAATCCGGGGCTGTATGACATGCTG
ACCAACGGGGTATTGCAGGCCAATGTTGCGTTCGACAAGGCCCAGTTTAATTGTCAGAACATGGCCAGAC
GAATGGGGGATTTTGCGCAAAACAACAAATGGAGCCAATCGGCCTCTTTACAGGAGTACAAAAATCAGGT
CAACGGCGGGGATGCTGACGCGGTGAGGGCCAATAATGCCGGCACCAGAGCCACCGGGACGGGCGGGCAT
CCGTGGATTGGCGGCCGGAAGCAGGGCGGTAAAGGGCAGAGTGCCATTCGTCCGACCCGTGATTTAGCCA
GTGCCGGGTTTAATATGATGAACCATCAGCCGGTACTGAGCACCGCCGCCATCCGGCATCAGGATTGCAG
CGGCAGCAGTTGCACCAAATTCAGCAGTGCGCGTGAGGCAGCAGAAGCGGTCGTCAACGTGCTGGGTGAC
CGTGCAATCCGTACTTGTGCCAACGCGGCGGAGTGCATCAGCGGCGGGGAGGCGCACCAGCCGGGCACCA
CCGTTGCTGGCACGGGTTTTGCGCCGATGCTGGAAGCCCAGACTCAGGCCAATATGGAACAGCTGGTGAA
GCTGGTTAACGGGACGGAAAAACCGACGGCGCCAAATCTGGCCAAACTGAAAACCGGCAGCCTGACCATC
ACCCGGGGCGTGATTCAGGCATTGCAGCGCGACCCCGATAATGCCGCACTGACAGCCCGTCTGGCGGGTG
AGCTGGCGATGGCAGAGACCACGGAGACGGCATTGCTGATGCGCCGGATGCTGATTACCGGCATGTCCGA
ACCCAATGCCGCCGCGCAGGCCGAAGCCCTCAATGAGGGCGAACGGCGGATTGCGGCGCTGGACAGGGAA
ATCACTGCGCTGAAAAATGAAATGACTCTGAAACAGGAGCTGGCGCGCAATTCCATCCTGACCATTATTG
CGCGGGAAAACCACCGGATTGAAGCGCATCCGCAGAAACACGTGACGGAAAGCAGTGATAAGCGTTTCTA
TCAACTGGAAAATCCGGCAAACCGGGTGACGGGAAGGTAA
 Primer design