SecReT4
Protein ID: 300724476
T4SS name [ID]Tfc [696]
Gene symbol-
Locus tagXNC1_3667
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3533428..3534186 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDD3VAD4
KEGG IDxne:XNC1_3667
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.1e-70, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|300724476|ref|YP_003713797.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MAQSENHSRPSSQPPRKPGLLYRLLWEWPWQLIGFMVMSWLFSLLLEYLGMAFFWPEQGATHSQNMMKIE
LKFLSTEFTRSLLLAEPSQTVSAGLAQAYQWLFVDSGFMGWVQGQSQYQFNSRNDFMRELNSVLQGVSGH
LREYWLATVFITMVTLIRLGILLLSVPLFVMVVLVALVDGLGRRDLRRYGAGYESSFVYHHAKRGIKPAC
TVPCVLYLSWPEVVYPTVILLPAAVLLGMAVVITTSMFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3533428-3534186 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGGCACAGTCAGAAAATCACTCCCGCCCGTCTTCCCAACCGCCCCGCAAGCCTGGCCTGTTGTATCGTC
TGTTATGGGAATGGCCGTGGCAACTTATTGGGTTTATGGTGATGTCCTGGCTGTTCAGCCTGTTACTGGA
ATATCTCGGGATGGCTTTTTTCTGGCCGGAACAGGGTGCCACTCACAGTCAGAATATGATGAAAATTGAA
CTTAAATTTTTATCCACGGAATTTACCCGAAGCCTGTTGTTGGCTGAGCCTTCACAAACCGTTTCGGCAG
GGTTGGCGCAAGCCTATCAATGGCTGTTTGTGGACAGTGGTTTTATGGGCTGGGTTCAGGGACAGTCGCA
ATACCAGTTCAATAGCCGCAATGATTTTATGCGTGAATTAAATTCCGTATTACAGGGTGTATCGGGGCAT
TTGCGGGAGTATTGGCTGGCCACGGTGTTTATCACGATGGTGACGCTGATCCGGCTGGGGATCCTGCTGT
TATCCGTGCCCCTGTTTGTAATGGTGGTGTTAGTGGCACTGGTTGACGGGCTGGGACGACGGGATTTGCG
GCGCTACGGAGCCGGGTATGAATCCAGTTTTGTCTATCACCATGCCAAACGGGGAATTAAACCGGCCTGC
ACGGTTCCCTGTGTACTGTATTTATCATGGCCGGAGGTAGTGTATCCCACGGTGATATTGTTGCCTGCGG
CGGTGTTGCTGGGTATGGCGGTGGTGATAACAACGTCGATGTTTAAGAAATACTTATAG
 Primer design