SecReT4
Protein ID: 300724481
T4SS name [ID]Tfc [696]
Gene symbol-
Locus tagXNC1_3672
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3538634..3538963 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD3VAD9
KEGG IDxne:XNC1_3672
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.7e-22, Aligned region: 24..103
Protein Sequence: 109 a.a.     [Download]
>gi|300724481|ref|YP_003713802.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MRGDFSLSRSVCLLGLTVLCMPLAQAAEKDELASAKNLIEQVQMALERANLAEKQADTPTRPRYDFDYLR
IKADLNTIKAGIDHYLTPSRAQQQASGTLSGHYRQEHPQ
 
Nucleotide Sequence: 330 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3538634-3538963 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCGTGGTGACTTTTCTTTGTCCCGTTCTGTCTGTCTGCTGGGGTTGACTGTGCTGTGTATGCCGCTTG
CGCAGGCGGCCGAGAAAGACGAACTGGCGAGTGCAAAAAATCTGATTGAGCAGGTGCAGATGGCGCTGGA
GCGTGCAAACCTCGCCGAAAAGCAGGCTGACACCCCAACCCGCCCTCGCTATGACTTTGATTACCTCCGT
ATCAAAGCGGATCTCAACACCATCAAAGCCGGTATTGATCACTACCTGACCCCTTCCCGCGCCCAGCAGC
AGGCGTCAGGCACGCTATCCGGTCATTACCGTCAGGAACATCCGCAATGA
 Primer design