SecReT4
Protein ID: 300724484
T4SS name [ID]Tfc [696]
Gene symbol-
Locus tagXNC1_3675
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T4SS(s) in this replicon]
Location [Strand]3539620..3539994 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDD3VAT1
KEGG IDxne:XNC1_3675
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.1e-41, Aligned region: 1..118
Protein Sequence: 124 a.a.     [Download]
>gi|300724484|ref|YP_003713805.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MQTIPFLPDRLNAEPIVFRGFTTPEMGLAALLGLVFGLMVSLPFIPLAGWVMIPTGMLFMPLLLISFGGR
WLAQLKRGKPENYLWLTLEEKKRRLGIGDPALIIAAQGWSLRRSRLTHRNGSLR
 
Nucleotide Sequence: 375 bp     [Download]
>gi|300721089|ref|NC_014228.1|:3539620-3539994 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCAGACGATCCCTTTCCTGCCTGATCGCTTAAATGCCGAACCGATCGTATTCCGGGGATTCACCACAC
CGGAAATGGGGCTGGCCGCTTTGCTGGGGCTGGTGTTCGGGCTGATGGTGAGCCTTCCTTTTATCCCGTT
AGCCGGCTGGGTCATGATACCGACGGGTATGCTGTTCATGCCCTTGTTATTGATTAGTTTTGGTGGGCGC
TGGCTCGCGCAGCTTAAGCGCGGCAAACCGGAAAATTATCTCTGGCTGACGCTGGAAGAGAAAAAACGCC
GGCTGGGTATCGGTGATCCGGCATTGATTATTGCGGCTCAGGGCTGGTCGTTGCGCCGAAGCAGGCTGAC
TCATCGTAACGGGAGCCTGCGATGA
 Primer design