SecReT4
Protein ID: 300781867
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200450
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]38394..39848 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDD8MJB3
KEGG IDebi:EbC_pEb10200450
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 484 a.a.     [Download]
>gi|300781867|ref|YP_003739102.1| hypothetical protein EbC_pEb10200450 [Erwinia billingiae Eb661]
MSQVKLKPATLALFIATVAISAQAADDNQSTEFGISLPSVNNSAIGYGKDVSGAVSDKLYYTLGGGSVIS
QPATRSNMRKVGMSAGWSSDLMCGNFDLKTTVGNQLNGVTNGFKNLMGDVVQNATGAVASLPAMIIQRAN
PGLYDMLTNGVLQANVSFDKAQLNCQNMSKRMMDFAGNNKWTQGAVMDEYRSLVNSGDADAVRVNNSADK
LQGNSGQNWIGGQKRGGQGQQAIRPTHDLTAAGFNMMNSLPVLSADTVSSNSCNGGACGKYASAEEAAKA
VVQVVGDSSLRTCTDASQCTSGDDEQQPGATQAGTGFAPILEETTKENTEQLVKLVNGTEQPNAANLAKL
KTGSLPITAGVIRALQRDPDNAALTARLAGELSMADTVETALIMRRMIVTGMSEPNAAAQNAAIEEGDRR
VAAIDREITALRNEMELKRELSRNSVLTIIERENGRVNSNPQTQSDDSTDSRVNRLAVPETENN
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c39848-38394 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
ATGTCACAAGTTAAATTAAAACCAGCCACGCTTGCACTGTTCATCGCCACGGTAGCGATATCCGCGCAGG
CGGCCGACGATAATCAGTCCACTGAGTTTGGAATCTCACTACCCTCCGTTAATAACAGCGCCATAGGCTA
TGGAAAAGACGTTAGCGGCGCTGTTTCTGACAAGCTCTATTATACGCTCGGCGGCGGGTCGGTAATTTCA
CAGCCGGCGACGCGCAGCAACATGCGTAAAGTCGGTATGAGTGCTGGTTGGAGCAGCGATCTGATGTGCG
GTAATTTCGACCTTAAAACAACCGTTGGTAATCAGCTCAATGGGGTAACAAACGGTTTTAAAAACCTGAT
GGGCGACGTGGTTCAGAACGCCACCGGTGCAGTAGCCAGCCTGCCGGCAATGATTATTCAGCGTGCTAAT
CCCGGCCTGTACGACATGCTCACGAATGGCGTTCTGCAGGCAAATGTCTCCTTTGATAAAGCACAGCTCA
ACTGCCAGAACATGTCCAAGCGCATGATGGATTTTGCCGGCAACAACAAATGGACGCAGGGCGCGGTAAT
GGATGAGTACCGATCACTAGTTAACAGCGGAGATGCAGATGCTGTCCGTGTGAATAACTCAGCGGACAAG
CTGCAGGGTAATTCAGGCCAGAACTGGATTGGTGGGCAGAAGCGAGGAGGACAAGGACAGCAGGCTATAC
GACCAACCCACGACCTAACCGCTGCAGGGTTCAATATGATGAACAGCCTGCCGGTACTGAGCGCTGACAC
GGTCAGCAGCAACAGCTGCAACGGCGGTGCGTGTGGAAAATATGCCAGCGCAGAAGAAGCGGCTAAAGCC
GTGGTCCAGGTGGTGGGAGACAGCTCTCTGCGCACCTGCACCGATGCTTCACAGTGCACCAGTGGTGATG
ACGAACAGCAGCCGGGCGCGACGCAGGCCGGCACCGGTTTTGCGCCCATTCTGGAAGAGACTACAAAAGA
AAACACCGAGCAGCTGGTAAAACTGGTGAACGGCACCGAGCAGCCTAACGCAGCGAATCTGGCAAAGCTT
AAAACCGGCAGTTTACCAATTACTGCAGGAGTTATCAGAGCTCTGCAGAGGGATCCTGACAATGCGGCCC
TGACCGCCCGACTCGCCGGTGAGCTTTCAATGGCTGACACGGTTGAAACCGCGCTGATCATGCGCCGCAT
GATTGTTACCGGCATGTCTGAACCTAACGCTGCGGCACAGAATGCGGCTATTGAAGAAGGGGACAGGCGT
GTTGCGGCCATCGATCGTGAGATCACGGCATTGCGTAATGAAATGGAGCTTAAGCGCGAGCTGTCACGCA
ATTCTGTGCTCACCATCATCGAGCGGGAAAACGGGCGCGTTAACAGTAATCCTCAGACGCAGAGCGATGA
CAGCACTGACAGTCGCGTTAATCGTCTGGCCGTACCTGAAACGGAAAACAACTGA
 Primer design