SecReT4
Protein ID: 300781877
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200550
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]49317..49682 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDD8MJE5
KEGG IDebi:EbC_pEb10200550
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.4e-41, Aligned region: 2..118
Protein Sequence: 121 a.a.     [Download]
>gi|300781877|ref|YP_003739112.1| hypothetical protein EbC_pEb10200550 [Erwinia billingiae Eb661]
MATIRFLPDRLNAEPVVFRGFTTPELGLAALIGALSGFVLSLPFAFVFGWLAIPTGTLLFPLVLIAFGGK
WLASKKRGKPDTFLWQRFDLKKRRMGLGDPRLIIDSRGWSLRRSKNSRSTK
 
Nucleotide Sequence: 366 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c49682-49317 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
ATGGCGACCATCAGATTTTTACCGGATCGCCTGAACGCTGAGCCAGTGGTATTCCGGGGGTTTACCACCC
CCGAGTTAGGGCTGGCGGCGCTGATTGGCGCATTATCCGGTTTCGTGCTGTCTTTGCCCTTCGCTTTTGT
TTTCGGCTGGCTTGCTATTCCAACCGGCACGCTGCTTTTCCCGCTTGTACTCATTGCATTTGGCGGCAAA
TGGCTTGCCAGCAAGAAACGAGGTAAACCCGATACGTTTCTCTGGCAACGGTTTGATTTGAAAAAACGCC
GCATGGGGCTGGGCGATCCCAGATTAATTATTGATTCGCGGGGCTGGTCCCTGCGACGCAGCAAGAACTC
CAGGAGTACAAAATGA
 Primer design