SecReT4
Protein ID: 300781880
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200580
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]50371..50832 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDD8MJE8
KEGG IDebi:EbC_pEb10200580
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.5e-28, Aligned region: 66..148
Protein Sequence: 153 a.a.     [Download]
>gi|300781880|ref|YP_003739115.1| hypothetical protein EbC_pEb10200580 [Erwinia billingiae Eb661]
MNPFNPAFALVFKFSFSQKELTAELVSVISHAYPTQQPLGVHMKSLCPATRLLLCGGVLGLTSLASSPAS
ASEKDELASAQRMIVQVQASLERARIAAVQADPSERGRYFFDYQRANSDLKTISSGIDRYLEPTRAQPRD
LSGVAGNYRRERP
 
Nucleotide Sequence: 462 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c50832-50371 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
TTGAACCCATTCAACCCGGCATTCGCGCTGGTCTTTAAATTTTCATTTTCCCAAAAAGAGTTAACGGCTG
AACTCGTTAGCGTGATTTCGCATGCTTACCCCACACAACAACCATTGGGGGTGCATATGAAATCTCTTTG
TCCGGCAACACGACTTTTGTTATGCGGCGGTGTGCTGGGCCTGACCTCTCTAGCGTCATCTCCCGCGTCT
GCATCTGAGAAAGACGAGCTTGCATCCGCGCAGCGGATGATCGTTCAGGTTCAGGCGTCGCTGGAGCGGG
CGCGTATTGCCGCAGTCCAGGCTGATCCGTCAGAGCGTGGCCGCTATTTCTTCGATTATCAGCGTGCAAA
TTCTGACCTGAAGACCATCAGCTCTGGCATCGATCGCTATCTGGAACCAACGCGTGCTCAGCCGCGAGAT
TTGTCAGGCGTGGCGGGGAATTATCGCCGGGAGCGTCCCTGA
 Primer design