SecReT4
Protein ID: 300781882
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200600
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]54085..54858 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDD8MJF0
KEGG IDebi:EbC_pEb10200600
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6.5e-70, Aligned region: 54..254
Protein Sequence: 257 a.a.     [Download]
>gi|300781882|ref|YP_003739117.1| hypothetical protein EbC_pEb10200600 [Erwinia billingiae Eb661]
MAEARRTSPQQYPQQQPMPPRENGLLYNLVWGWPWKLIGVILASLMVSLVIEYIGIAFFWPEQGAAHSQA
VMDTEFGYLSSDFTRSLLLSEPAATVTRWITDAYQWAFVDSGILSWIQEKYQAEMNSGNEVSRNLKGASS
WLGNYLQQYMLATVYVSIVTLIRVTIIALSVPLFVLVICVAVVEGLGRRDLRRFGAGYESSFLYHRAKRL
IKPAVYLPVMAYLSWPSAVYPNLLLLPAALMLGLTITVTTASFKKYL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c54858-54085 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
ATGGCTGAGGCTCGTCGTACTTCACCACAGCAGTATCCGCAGCAGCAGCCGATGCCGCCGCGTGAAAATG
GATTGTTATATAACTTGGTCTGGGGCTGGCCGTGGAAGCTCATCGGCGTGATCTTGGCTTCGCTGATGGT
GAGCCTTGTCATTGAGTACATCGGGATCGCGTTTTTCTGGCCTGAACAGGGGGCCGCTCACAGCCAGGCT
GTAATGGATACTGAGTTTGGCTATCTGTCTTCTGATTTTACCCGCAGCCTGCTGCTTTCTGAGCCAGCTG
CAACGGTTACCCGCTGGATAACGGATGCATACCAGTGGGCGTTTGTGGACAGCGGCATCCTGAGCTGGAT
TCAGGAAAAATATCAGGCCGAAATGAACAGCGGCAATGAGGTATCACGCAATCTCAAAGGGGCCAGCAGC
TGGCTGGGAAATTACCTTCAGCAATACATGCTTGCAACGGTTTATGTGTCAATCGTAACGCTGATCCGCG
TCACCATCATTGCGTTGTCCGTGCCGCTGTTCGTATTAGTTATTTGTGTCGCCGTGGTTGAAGGGCTTGG
ACGACGGGATTTGCGTAGATTTGGGGCCGGCTATGAATCGTCATTTCTGTACCATCGCGCAAAAAGGTTG
ATCAAGCCAGCAGTATATCTGCCGGTGATGGCCTACCTTTCATGGCCTTCGGCGGTCTATCCAAACCTGC
TGCTGCTGCCGGCAGCGTTAATGCTGGGGCTTACCATTACGGTAACTACGGCTTCCTTCAAAAAATATTT
ATAA
 Primer design