SecReT4
Protein ID: 300781883
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200610
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]54851..56950 [-]
Productplasmid transfer protein
Component typeTfc6
UniProt IDD8MJF1
KEGG IDebi:EbC_pEb10200610
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.1e-15, Aligned region: 502..632
TrwB_AAD_bind [PF10412], Evalue: 3.4e-13, Aligned region: 178..225
TrwB_AAD_bind [PF10412], Evalue: 3.4e-13, Aligned region: 498..642
AAA_10 [PF12846], Evalue: 1.2e-08, Aligned region: 187..579
Protein Sequence: 699 a.a.     [Download]
>gi|300781883|ref|YP_003739118.1| plasmid transfer protein [Erwinia billingiae Eb661]
MSDKYVIEALLRPAVELNTAVVAGTAAIICVTAPWAVALAPSVSCVTAGGFAVLSAVRARQGMQVIHYRR
NLRRLPRYVMTSKQIPVSKRRLFIGRGFRWTQKHTQRLRDTLRPEVAHYLKPSKLYQLARRIEEATEKTL
PAIGRLLSADRVLNPVRPLPPVGGNPAIHGIEPNETDVTLDLRERVGHTVVYGTTRVGKTRLAELLITQD
IRRGDVTIVFDPKGDADLLKRVWAEAHRAGRGDELTVFHLGWPDISARYNAVGRFGRVSEVATRVAGQLS
GEGNSAAFREFAWRFVNIVARALVALGERPDYTRITRYVNNIADLYLRYAEKIITEQMPELNSQIENNAN
AFSEDDVPRNMQGQPEAVRIWAVEVALSSDVGQQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLSPDYLNMEDPRPIFDWEQVIRKKGIVYVGLDALSDSEVASAVGNSMFADLVSVAGQIYKHGIN
GGLPGSREGNDPINLHCDEFNELMGNEFIPLINKGGGAGMQVTAYTQTSSDIEARIGSAAKTAQVQGNFN
NLIMLRVKENRTAELLTSQLPQVEIYSKTLVSGHQDSADVTVNHDFTSSTQDRVGTIKVPLLEPSDIVTL
PKGQAFALLEGGQLWKIRMPLPAGDAGDVHMPANIARLAEEMRRNYHSSEGWWDSRVSAAALVKGDNNG
 
Nucleotide Sequence: 2100 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c56950-54851 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
ATGAGTGATAAATACGTAATCGAGGCACTACTGCGCCCGGCTGTAGAGCTCAATACTGCCGTTGTTGCCG
GCACCGCCGCCATCATATGCGTTACCGCGCCTTGGGCGGTGGCACTCGCGCCTTCCGTCAGCTGCGTCAC
CGCCGGAGGATTCGCGGTTCTTTCTGCTGTGCGCGCGCGTCAGGGAATGCAGGTGATCCACTACCGCCGT
AATCTGCGACGTCTGCCGCGTTACGTTATGACGTCAAAACAGATCCCCGTCAGTAAACGCCGGCTCTTTA
TTGGCAGAGGGTTTCGCTGGACTCAGAAGCATACCCAGCGCCTGCGCGATACGCTGCGCCCCGAGGTAGC
CCACTATCTGAAGCCCTCGAAACTGTATCAGCTTGCCCGCAGGATTGAGGAGGCCACAGAGAAAACGCTG
CCAGCGATCGGCAGACTGCTCAGTGCTGACAGGGTGTTAAATCCGGTCCGTCCGCTGCCTCCGGTTGGCG
GCAATCCGGCAATCCATGGCATAGAACCAAATGAAACTGATGTTACGCTCGATTTACGGGAGCGTGTGGG
CCATACGGTTGTGTATGGCACTACCCGCGTGGGCAAAACGCGCCTTGCTGAGCTTTTAATTACTCAGGAT
ATACGGCGCGGTGACGTCACCATCGTGTTTGATCCGAAAGGAGATGCTGACTTGCTGAAAAGGGTCTGGG
CGGAAGCTCACCGGGCTGGTCGGGGCGATGAGCTGACCGTTTTTCATCTGGGCTGGCCTGACATATCAGC
ACGGTATAACGCCGTAGGCCGTTTCGGCCGCGTATCGGAAGTGGCTACCCGCGTTGCCGGCCAGCTCAGC
GGTGAAGGTAACAGCGCGGCGTTCCGAGAGTTTGCCTGGCGATTCGTGAACATCGTTGCCAGGGCGCTGG
TTGCCCTTGGGGAGCGTCCGGATTACACCCGGATTACACGCTATGTGAACAATATTGCTGATTTGTACCT
GCGCTACGCTGAAAAAATCATTACTGAGCAAATGCCCGAACTGAACAGTCAGATCGAAAATAACGCGAAT
GCCTTCAGTGAAGACGATGTGCCGCGCAACATGCAGGGCCAGCCTGAAGCTGTGCGCATATGGGCGGTTG
AGGTGGCGCTGAGTTCTGATGTCGGCCAGCAGCTTTACGATCCGATTCTTGATGGCCTTCGGTCGGCTGT
GCGTTATGACCGCACTTATTTTGACAAAATTGTTGCGTCATTACTGCCGCTTCTGGAAAAGCTGACAACG
GGCAAAACGGCTGAGTTACTGTCACCCGATTACCTGAACATGGAAGATCCGCGACCCATTTTTGACTGGG
AACAGGTTATCCGTAAAAAAGGCATCGTCTACGTAGGCCTCGATGCGCTCAGCGACAGCGAGGTTGCCAG
CGCCGTGGGTAATAGTATGTTTGCCGATCTGGTGAGTGTGGCGGGACAGATTTACAAGCACGGTATCAAC
GGCGGCCTGCCTGGCTCCCGGGAAGGTAACGATCCAATCAACCTTCACTGCGACGAGTTCAATGAACTGA
TGGGGAACGAATTTATACCCCTTATCAACAAAGGCGGCGGTGCCGGCATGCAGGTTACGGCTTATACACA
GACGTCATCAGATATTGAGGCCCGGATCGGAAGTGCGGCAAAAACCGCTCAGGTGCAGGGTAACTTCAAC
AACCTGATCATGCTGCGCGTGAAGGAAAACAGGACGGCCGAGCTGCTGACCTCGCAGCTGCCGCAGGTTG
AAATCTACAGCAAAACGCTGGTCTCAGGGCATCAGGATTCAGCTGACGTCACCGTCAACCATGATTTCAC
CTCCAGCACACAGGACCGCGTCGGCACGATCAAAGTGCCATTACTGGAGCCATCGGACATCGTCACGCTG
CCAAAAGGTCAGGCATTTGCGCTGCTTGAAGGTGGTCAGCTCTGGAAGATACGCATGCCGCTGCCGGCTG
GCGATGCCGGCGACGTGCATATGCCTGCAAACATAGCGCGTCTGGCGGAAGAAATGCGGCGCAACTATCA
CAGCAGTGAGGGATGGTGGGACAGTCGCGTTTCGGCAGCAGCGCTGGTAAAGGGAGATAATAATGGCTGA
 Primer design