SecReT4
Protein ID: 300781886
T4SS name [ID]Tfc [721]
Gene symbol-
Locus tagEbC_pEb10200640
StrainErwinia billingiae Eb661
Repliconplasmid pEB102 [GenBank: NC_014304] [Browse all T4SS(s) in this replicon]
Location [Strand]58022..58624 [-]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDD8MJF4
KEGG IDebi:EbC_pEb10200640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|300781886|ref|YP_003739121.1| lytic transglycosylase, catalytic [Erwinia billingiae Eb661]
MAMMLIPLSTFADGKQMVPEGYVRVAQAHSVPPESLYSVSLQESSRRLPQGERPWPWTLNVAGKGYRYKT
RLEAWQALQVFMKKNSLKRIDVGIAQVNLGWNGQRFSSTWEALDPYKNLNAAAAILRECWDRKPGSWLDA
AGCYHHPAGGAPAARYRAFVKTKLALLQSSPHLPAATAVEQTASASVPDTGLVWINPRSQ
 
Nucleotide Sequence: 603 bp     [Download]
>gi|300781822|ref|NC_014304.1|:c58624-58022 Erwinia billingiae Eb661 plasmid pEB102, complete sequence
GTGGCGATGATGCTTATCCCTCTCTCCACGTTCGCAGATGGCAAACAGATGGTCCCAGAGGGATACGTGC
GCGTTGCGCAGGCTCACAGCGTGCCGCCCGAGTCGCTCTATTCCGTCAGCCTGCAGGAATCATCGCGCCG
CCTGCCGCAGGGTGAGCGCCCGTGGCCGTGGACCCTTAACGTGGCGGGCAAGGGATATCGTTATAAAACC
CGTCTGGAAGCGTGGCAGGCGCTGCAGGTTTTCATGAAGAAGAACTCCCTGAAGCGCATTGATGTAGGGA
TTGCTCAGGTTAATCTTGGCTGGAACGGGCAGCGCTTCTCGTCCACTTGGGAAGCGCTGGATCCTTACAA
AAATCTGAACGCCGCTGCCGCCATTCTGCGCGAGTGCTGGGACAGAAAACCGGGCAGCTGGCTCGATGCA
GCCGGCTGCTATCACCACCCCGCTGGCGGCGCTCCCGCTGCCCGCTATCGCGCTTTTGTCAAAACCAAAC
TCGCCTTGCTCCAGTCCTCACCGCATCTGCCGGCGGCGACTGCGGTTGAGCAGACAGCATCCGCATCGGT
GCCGGATACCGGCCTCGTCTGGATAAATCCACGGAGTCAGTGA
 Primer design