SecReT4
Protein ID: 300837050
T4SS name [ID]Tra_F [107]
Gene symboltraL
Locus tagpKP048_p111
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]96234..96539 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDD5KTR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-38, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|300837050|ref|YP_003754104.1| conjugal transfer pilus assembly protein TraL [Klebsiella pneumoniae]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGIASAVLVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|300836939|ref|NC_014312.1|:96234-96539 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATTTT
TGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design