SecReT4
Protein ID: 300837069
T4SS name [ID]Tra_F [107]
Gene symboltraF
Locus tagpKP048_p130
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]110776..111477 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDD8L2Q2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.2e-77, Aligned region: 9..223
Protein Sequence: 233 a.a.     [Download]
>gi|300837069|ref|YP_003754123.1| conjugal pilus assembly protein TraF [Klebsiella pneumoniae]
MPAFAKDAGWQWYNEKLKPRDEDRKAVPAAPPPQMDILEKLATLQAATKRSLYEAILYPSSENFVKYFRL
QNYWTQQAGLFSMSAKKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGRE
AIDGQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVNPKSGQVKPLSY
GFISQDDLAKQFLYVSSDFKPNF
 
Nucleotide Sequence: 702 bp     [Download]
>gi|300836939|ref|NC_014312.1|:110776-111477 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGCCGGCTTTCGCCAAAGACGCGGGCTGGCAGTGGTACAACGAGAAACTGAAGCCCCGTGATGAGGACA
GGAAAGCCGTACCAGCGGCACCACCGCCGCAAATGGATATTCTGGAGAAACTCGCCACACTCCAGGCGGC
CACCAAACGGTCGTTGTACGAAGCCATTCTGTATCCATCGTCTGAAAACTTCGTGAAGTATTTCCGGCTG
CAGAACTACTGGACGCAGCAGGCAGGTTTGTTCTCGATGAGTGCGAAGAAAGCCATGCTGGAAAACCCCG
AACTCGATTACAACCTGCAGTACAGCCACTACAACGGCACGGTAAAAAACCAGCTCGCTGCCGACTATGC
CGAACAGCGACAGGCTATCTCCACCCTCGCACAGCACTACGGCGTGATGTTCTTCTACCGGGGCCGGGAA
GCGATCGATGGCCAGCTGGTCCAGGTGATTAAAAATTTTCGCGAAACCTATGGCCTGAGCGTGATACCGG
TGTCGGTTGACGGAGTGATTAACCCCATGCTGCCCGACAGCCGGACGGACCAGGGCCAGGCAGAGCAGCT
TGGCGTGAAGTTCTTCCCCGCGATGATGCTGGTTAACCCTAAAAGTGGCCAGGTGAAGCCTCTCAGTTAC
GGCTTTATCAGTCAGGACGACCTGGCGAAACAGTTCCTCTATGTCTCCAGCGACTTTAAACCGAATTTCT
AA
 Primer design