SecReT4
Protein ID: 300837070
T4SS name [ID]Tra_F [107]
Gene symboltraQ
Locus tagpKP048_p131
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]111488..111727 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDD5KTT2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.8e-35, Aligned region: 1..71
Protein Sequence: 79 a.a.     [Download]
>gi|300837070|ref|YP_003754124.1| conjugal transfer pilin chaperone TraQ [Klebsiella pneumoniae]
MRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIFGLGMVVFGGYRILNALIAEAEKEEKA
CEKQPDEPR
 
Nucleotide Sequence: 240 bp     [Download]
>gi|300836939|ref|NC_014312.1|:111488-111727 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGCGAAATATTCGTTTTCCGGATTTAGATATCACCGGGATGTGGGTGCTGGCCGTGGGCGTGTTTTTCC
ACCTGATAGCCCGGCTTGTCAGAAAACAGCCTGAGCTGGCCGTCCAGGCCGGGGAAATCTTCGGGCTGGG
TATGGTGGTGTTCGGGGGATACCGCATTCTAAACGCCCTGATTGCTGAAGCCGAAAAAGAGGAGAAAGCC
TGTGAAAAACAGCCTGATGAACCTCGCTAA
 Primer design