SecReT4
Protein ID: 300837080
T4SS name [ID]Tra_F [107]
Gene symboltraX
Locus tagpKP048_p141
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]127191..127916 [+]
ProductF pilin acetylation
Component typeTraX_F
UniProt IDD8L2R3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3.6e-51, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|300837080|ref|YP_003754134.1| F pilin acetylation [Klebsiella pneumoniae]
MRAQHTFPDATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNNLWGWALVAQVSFMLIGYPWYTGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVT
WIPLSTGSYGMAGVGMLTASWLLCRAQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
AGERVKRFWPRQFFVMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|300836939|ref|NC_014312.1|:127191-127916 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGAGAGCACAACACACATTTCCAGACGCGACAGACAGCTGGCTTCAGCGCCTGCTGACCTGGACACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACTGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGTGGTTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AATCTGGCACGGCACGCGGAAATACGCCAGTCTCAACTGAACAACCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTCATCGGGTACCCGTGGTATACCGGGAATATTCTGTTTGCCTTTGCCGTTACGGG
CCAGGTCCTGCGGTGGGTCAGCCAGCCGTCCTGGTATTACACCCTCCCGGCGGCTGGACTGCTGGTCACC
TGGATACCCCTGTCAACCGGCAGCTACGGCATGGCTGGAGTGGGCATGCTCACCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACCGGAACGGCTGGGATACGGGGTGTTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGGCTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
GCCGGAGAACGTGTGAAACGCTTCTGGCCGCGGCAGTTCTTCGTGATGTTCTATGCCGTGCACCTGGCGG
TACTGGGTATTGTCGTCTCAATGTGA
 Primer design