SecReT4
Protein ID: 302141560
T4SS name [ID]Trw [151]
Gene symboltraL
Locus tagpNL194_p04
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]2340..3074 [+]
ProductTraL
Component typeTrwN
UniProt IDE2EAN5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 6.7e-34, Aligned region: 31..176
Protein Sequence: 244 a.a.     [Download]
>gi|302141560|ref|YP_003813019.1| TraL [Klebsiella pneumoniae]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGSIQLK
QQPRTEAEAVSVAKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKSY
PAGQVALRHALSCYNTGSLTNGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTANEPQQAKSTAPQ
YDGEQDVFGSGDGDAFSRNNTDAFLTRQETAKGE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|302141556|ref|NC_014368.1|:2340-3074 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGAGTAAACATCCAAAACTCCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCCGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACGATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGACCGTACAGGATCAATATTAACGGTAGTATTCAGTTAAAA
CAGCAACCGCGTACTGAAGCTGAGGCCGTCAGCGTTGCGAAAGTTCTGCTGAAGGATAATAAAAGTTTTG
ATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAA
ACCCTGCATCAACCTGCGGGCGAGCCAGACCATTCTTAAAGCCTGTTATGATAGCGCCCTGAAATCCTAC
CCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCACAAACGGGATTT
CTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCTGCT
ACCTGACGGCCAGACCAGTGAGGACAGCACCGCGAATGAGCCTCAGCAGGCAAAAAGTACGGCGCCGCAG
TATGACGGTGAACAAGATGTTTTTGGTTCTGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATGCCT
TTTTAACCAGACAGGAAACAGCGAAGGGGGAATGA
 Primer design