SecReT4
Protein ID: 302141562
T4SS name [ID]Trw [151]
Gene symboltraM
Locus tagpNL194_p06
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]3374..3667 [+]
ProductTraM
Component typeTrwL
UniProt IDE2EAN7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|302141562|ref|YP_003813021.1| TraM [Klebsiella pneumoniae]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASYLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|302141556|ref|NC_014368.1|:3374-3667 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCTCTGATTGGTATTGGTTCTGCATCATATCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design