SecReT4
Protein ID: 302141565
T4SS name [ID]Trw [151]
Gene symboltraC
Locus tagpNL194_p09
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]6651..7364 [+]
ProductTraC
Component typeTrwJ
UniProt IDE2EAP0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.8e-49, Aligned region: 25..216
CENP-Q [PF13094], Evalue: 4.5e-06, Aligned region: 33..137
Protein Sequence: 237 a.a.     [Download]
>gi|302141565|ref|YP_003813024.1| TraC [Klebsiella pneumoniae]
MKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKSQLQTQKNMYESMAKTTN
LGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEIDDMTPSEAITYMNKKLAEKGA
YDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|302141556|ref|NC_014368.1|:6651-7364 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGAAAAAAACACTGACGGCAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCG
CAGGCATCATCGTGACCAACCCTACTGAGCTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCA
GCTGGAGCAGCTTAAAAGCCAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAAC
CTGGGCGATCTGCTGGGGACGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATCT
ACAGCGACGCCATGAACTCCAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGC
GGAAATTGACGACATGACGCCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCT
TATGACCGCGTTATGGCAGAAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGA
CGGAGCAGATTAAAACGACTCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACA
GGGTGCTATTCAGGGTGAGCAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTA
TTACGTGCGCAGAAAGAACGTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design