SecReT4
Protein ID: 302141568
T4SS name [ID]Trw [151]
Gene symboltraN
Locus tagpNL194_p12
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]8741..8887 [+]
ProductTraN
Component typeTrwH
UniProt IDE2EAP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|302141568|ref|YP_003813027.1| TraN [Klebsiella pneumoniae]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGRNES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|302141556|ref|NC_014368.1|:8741-8887 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTCGAAATGA
AAGCTAA
 Primer design