SecReT4
Protein ID: 302141569
T4SS name [ID]Trw [151]
Gene symboltraE
Locus tagpNL194_p13
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]8877..9575 [+]
ProductTraE
Component typeTrwG
UniProt IDE2EAP4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-51, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|302141569|ref|YP_003813028.1| TraE [Klebsiella pneumoniae]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVALMSTPNVAESYQSK
FKGRNGLDKVLGDSETARVKINSVILDKPHGVRTIRFTTVRRVRTNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|302141556|ref|NC_014368.1|:8877-9575 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTAGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGCGTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAATGGTCTTGATAAGGTTCTGGGCGACAGTGAAACAGCCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTACGAACAATACGCTTTACTACGGTTCGCCGCGTGCGCACGAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCGGAAGTTAACTGA
 Primer design