SecReT4
Protein ID: 302141570
T4SS name [ID]Trw [151]
Gene symboltraO
Locus tagpNL194_p14
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]9586..10470 [+]
ProductTraO
Component typeTrwF
UniProt IDE2EAP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.4e-55, Aligned region: 33..267
Protein Sequence: 294 a.a.     [Download]
>gi|302141570|ref|YP_003813029.1| TraO [Klebsiella pneumoniae]
MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITH
AFGDSESRTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVR
HAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGRGAVATGT
ASPDVRRVQIGEDN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|302141556|ref|NC_014368.1|:9586-10470 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGTCAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGC
TTGAGGTTGGCCGCAATTCTCCTTATGACTATCGCATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGT
CAAAATTGACGCTGTCGCCGGTGTGGCTACCCACATTGTTGTCGCGCCTGACGAAACCTATATCACTCAT
GCTTTTGGCGATTCTGAAAGCAGGACGTTTGCGCACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGG
CCATGAGTGATACCAACCTGGTGATCGTCACCGATAAGCGCACCTATAACATCGTCCTCCATTTCATCGG
TGAAGAAACGAAGAAAAATGCAGACGGTACGGTATCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGC
CATGCCGTTCTTCAGCTGACCTATGAATATCCGTTTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATA
AAAAACGCATTACGCAGAAGCTGAAGCAGACGGCTTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAG
CGAACAGCCTGAAATGCGCAGCATCCAGCCGGTTCACGTCTGGGATAACTACCGCTTTACCCGGTTTGAG
TTTCCGGCCAATGCGGAGTTACCGCAGGTCTACATGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACT
CTCATGTTGTGGGTGAGAACCGCAACATCATCGAGGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCT
GGGCGATAAAGTCGTTGGCGTTCGTAATAATAATTTCGCGCCGGGCCGCGGTGCGGTAGCAACCGGTACG
GCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGGAGGATAACTGA
 Primer design