SecReT4
Protein ID: 302141571
T4SS name [ID]Trw [151]
Gene symboltraF
Locus tagpNL194_p15
StrainKlebsiella pneumoniae plasmid pNL194 (NC_014368)
Repliconplasmid pNL194 [GenBank: NC_014368] [Browse all T4SS(s) in this replicon]
Location [Strand]10470..11630 [+]
ProductTraF
Component typeTrwE
UniProt IDE2EAP6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.9e-54, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|302141571|ref|YP_003813030.1| TraF [Klebsiella pneumoniae]
MARKSVDVDQELDENTGDGEFESERGGFNGSNRRSAPRMKAFVILMALLALVFIGITVMGKIRAPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSPTDARAVQAAAQADADAGSSNTGARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGAQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDAHMWERLAGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGGQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|302141556|ref|NC_014368.1|:10470-11630 Klebsiella pneumoniae plasmid pNL194, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAATGGCAGTAACCGCCGTTCGGCTCCTCGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCGCCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCCCGACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGGCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGCGCAGCCCCAGGATAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGTAATGACCAGGACGGGACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATGCCCATATGT
GGGAGCGTCTGGCTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGCACAGAAAACAGCGGTGGGCAGCTGGCGTCTGAAGCACTCCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design