SecReT4
Protein ID: 302595287
T4SS name [ID]Tra_F [133]
Gene symboltraH
Locus tagpecB24_p05
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]6567..7943 [-]
Productconjugal transfer protein
Component typeTraH_F
UniProt IDQ5JBP4, B7LI86
KEGG IDecz:pECS88_0088
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.9e-117, Aligned region: 30..379
Protein Sequence: 458 a.a.     [Download]
>gi|302595287|ref|YP_003829002.1| conjugal transfer protein [Escherichia coli]
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQVKN
VQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKM
ASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDK
DKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAK
IYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDP
QMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c7943-6567 Escherichia coli plasmid pEC_B24, complete sequence
ATGATGCCACGCATTAAACCTCTTCTGGTTCTTTGTGCTGCTTTACTGACGGTCACACCCGCAGCGTCAG
CGGATGTGAACAGCGACATGAATCAGTTCTTTAACAAGCTGGGCTTCGCCTCCAATACCACACAGCCGGG
CGTCTGGCAGGGGCAGGCCGCCGGTTATGCTTACGGTGGCTCCCTGTATGCCCGTACTCAGGTCAAAAAT
GTTCAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTACCTCGGCT
CGTTCAGTTTTATTAATGGCGAGCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAATGCTGCCGGTTA
CTTTTTTGACCTTGCCCTGCAGACAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAGAAAATG
GCAAGCGACATTAACAGTATGAACCTCAGTTCCTGCCAGGCGGCACAGGGGATTATCGGCGGGCTTTTCC
CCCGGACGCAGGTGTCCCAGCAGAAAGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGCTGACTG
GGCGGCTTCCCGGCAGGGATGTACCGTTGGCGGGAAATCTGACAGTGTCAGGGATAAAGCCAGCGACAAG
GATAAGGAGCGGGTGACCAAAAACATCAACATCATGTGGAATGCGCTTTCCAAAAACAGAATGTTTGACG
GCAACAAAGAGCTGAAAGAGTTTGTGATGACGCTGACCGGCTCACTGGTGTTTGGTCCTAACGGCGAAAT
CACACCCTTGTCAGCCAGAACCACTGACCGCTCAATTATCCGGGCCATGATGGAAGGCGGCACAGCAAAA
ATTTATCACTGCAACGATTCTGATAAATGCCTGAAAGTGGTGGCAGACACACCGGTGACCATCAGCCGGG
ATAATGCACTGAAGTCTCAGATTACTAAACTTCTGGCCAGCATTCAGAACAAGGCGGTCAGTGACACGCC
TCTGGATGACAAGGAAAAAGGCTTTATTTCCAGTACCACCATCCCCGTCTTCAAATACCTGGTTGACCCG
CAGATGCTCGGTGTTTCCAACAGTATGATTTACCAGCTGACGGACTATATCGGTTACGACATCCTGCTGC
AGTACATTCAGGAGCTGATACAGCAGGCCCGGGCGATGGTGGCCACAGGAAATTATGACGAAGCAGTTAT
CGAACATATTAACGACAACATGAATGATGCCACCCGGCAGATTGCGGCGTTTCAGTCACAGGTGCAGGTA
CAGCAGGATGCGCTGCTGGTTGTCGATCGTCAGATGAGCTACATGCGTCAGCAGCTTTCCGCCCGCATGC
TCAGTCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design