SecReT4
Protein ID: 302595290
T4SS name [ID]Tra_F [133]
Gene symboltraQ
Locus tagpecB24_p08
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]8764..9048 [-]
Productconjugal transfer protein
Component typeTraQ_F
UniProt IDQ5JBP1, B7LI83
KEGG IDecz:pECS88_0085
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|302595290|ref|YP_003829005.1| conjugal transfer protein [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c9048-8764 Escherichia coli plasmid pEC_B24, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design