SecReT4
Protein ID: 302595292
T4SS name [ID]Tra_F [133]
Gene symboltraF
Locus tagpecB24_p10
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]9530..10321 [-]
ProductF pilus assembly
Component typeTraF_F
UniProt IDD9Z4V1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.7e-78, Aligned region: 39..253
Protein Sequence: 263 a.a.     [Download]
>gi|302595292|ref|YP_003829007.1| F pilus assembly [Escherichia coli]
MTCRNLMKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQK
LAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRN
QLAADQVQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTD
QGQAQRLGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 792 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c10321-9530 Escherichia coli plasmid pEC_B24, complete sequence
CTGACCTGCAGAAACCTGATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCAC
TGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAAT
AAATCCGAAGGAAAAAGAAAATAAACCAGTACCTGCAGCCCCCCGTCAGGAGCCGGACATTATGCAGAAA
CTGGCCGCACTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATT
TTGTGAAATATTTCCGGCTGCAAAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAA
AGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTCCGGAAC
CAGCTGGCGGCAGACCAGGTGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGT
TCTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTA
TGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGAC
CAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCA
GTGTTCGCCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGA
AGATTTTAAACCCAATTTTTAA
 Primer design