SecReT4
Protein ID: 302595294
T4SS name [ID]Tra_F [133]
Gene symboltraN
Locus tagpecB24_p12
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]10550..12358 [-]
Producttype IV secretion-like conjugative transfer system mating pair stabilization protein
Component typeTraN_F
UniProt IDD9Z4V3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.5e-74, Aligned region: 306..552
Protein Sequence: 602 a.a.     [Download]
>gi|302595294|ref|YP_003829009.1| type IV secretion-like conjugative transfer system mating pair stabilization protein [Escherichia coli]
MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQGFKPQESIPGYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRS
EYTNYTCERDLQVEQYCTRTARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVDAHYS
WSRTYLQKSVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMKLRLV
VRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSCWAYRDTYVTQSADKGT
CQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGKSNDFAE
AVSQLAALAAAGKDVAALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKS
NKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQ
FDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c12358-10550 Escherichia coli plasmid pEC_B24, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGCTCTGATTTTGCTCACCAGATCAAAGGACAGGGAAGCAGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCGGCTATAACGCGAATCCGGACGAGACAAAATACTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATCACAG
AGTCATTCATGAACAAGCCGAAAGACATTCTTTCACCGGATGCACCGTTTATCCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAACACCGGGCAGCAGTGCAGTGCGCAGGAGATTAGCCGGAGT
GAATACACGAATTACACCTGTGAGCGGGATTTACAGGTGGAGCAGTACTGCACACGAACTGCCCGTATGG
AGCTGCAGGGGAGTACCACATGGGAAACCCGGACGCTGGAGTATGAAATGAGTCAGCTACCTGCACGTGA
AGTGAATGGTCAGTATGTTGTCTCCATTACCTCTCCCGTTACCGGTGAAATTGTCGATGCGCATTACAGC
TGGAGTCGTACTTACCTGCAGAAGAGTGTACCTATGACAATTACAGTACTGGGAACCCCACTGAGCTGGA
ATGCCAAATACTCAGCAGATGCCTCATTTACACCAGTACAGAAAACACTGACTGCCGGTGTTGCTTTTAC
GTCATCTCACCCCGTCCGGGTCGGGAATACAAAATTCAAACGTCATACGGCAATGAAGCTGCGTCTGGTT
GTCAGGGTAAAAAAAGCCTCGTACACCCCGTATGTTGTCTGGTCTGAAAGCTGCCCGTTCAGCAAGGAGC
TGGGGAAACTGACAAAAACAGAATGTACGGAGGCTGGCGGGAACAGGACGCTGGTGAAAGACGGTCAGTC
ATACAGCATGTACCAGAGCTGCTGGGCATACCGGGACACGTATGTCACACAGTCAGCAGACAAGGGAACC
TGTCAGACCTACACCGACAATCCTGCCTGTACCCTGGTGTCACACCAGTGCGCCTTTTACTCCGAAGAAG
GTGCCTGTCTGCATGAATATGCCACGTACTCCTGTGAGTCAAAAACATCCGGGAAAGTGATGGTCTGTGG
GGGAGACGTCTTCTGTCTCGATGGCGAATGCGATAAGGCTCAGAGCGGGAAGAGTAATGATTTTGCCGAA
GCCGTTTCTCAGCTGGCGGCACTGGCCGCAGCAGGTAAGGATGTTGCGGCGCTGAACGGGGTGGATGTCC
GTGCTTTCACCGGTCAGGCGAAATTTTGTAAGAAGGCTGCAGCCGGATACAGCAACTGCTGTAAGGACAG
CGGCTGGGGACAGGATATCGGGCTGGCCAAATGCAGCAGTGATGAAAAAGCCCTGGCTAAAGCAAAATCA
AACAAACTGACCGTCAGTGTCGGAGAGTTCTGTTCGAAGAAAGTGCTGGGTGTCTGCCTGGAGAAAAAAC
GCAGTTACTGTCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCGCAACGGACAGCTGCG
TATCAGTTTTGGCAGTGCGAAGCATCCTGACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAG
TTCGACAGACTGGATTTCACTAACTTCTACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGTG
TTCTGACGCAGAAAGTGAAAGAGCAGATTGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design