SecReT4
Protein ID: 302595295
T4SS name [ID]Tra_F [133]
Gene symboltrbC
Locus tagpecB24_p13
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]12355..13020 [-]
Productconjugal transfer protein
Component typeTrbC_F
UniProt IDD9Z4V4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5.3e-28, Aligned region: 102..200
Protein Sequence: 221 a.a.     [Download]
>gi|302595295|ref|YP_003829010.1| conjugal transfer protein [Escherichia coli]
MVTMPSGYIMNWKIFALFALTAGMHITVHASDNVNTPENRQFLKQQENLSRQLREKPDHQLKAWAEKQVL
ENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKT
TAEAVLSLVKDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAH
DLLAGKGDSGK
 
Nucleotide Sequence: 666 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c13020-12355 Escherichia coli plasmid pEC_B24, complete sequence
ATTGTAACAATGCCATCAGGATATATCATGAACTGGAAAATATTTGCGCTTTTTGCCCTGACTGCAGGAA
TGCATATCACTGTTCATGCCTCAGACAATGTGAACACTCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGA
AAATTTAAGCAGACAACTGCGTGAAAAACCTGACCATCAGCTGAAGGCCTGGGCGGAGAAACAGGTGCTG
GAGAACCCCCTTCAGCGTTCAGATAACCATTTCCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGG
ACGGGAAACCCCGGCAGGGTGCTCTGTATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGGAT
GCTGGGCGAAACCCGGCACTACGGTATACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACC
ACCGCTGAAGCCGTGCTGTCCCTGGTGAAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGT
TTTCACAGTACGGCATTCGCAGTGTACCGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCG
GGGAAACCTGCGGGTCGGCCAGGCGCTGGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCAT
GATTTACTGGCAGGGAAAGGAGACTCCGGGAAATGA
 Primer design