SecReT4
Protein ID: 302595296
T4SS name [ID]Tra_F [133]
Gene symboltraU
Locus tagpecB24_p15
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]13990..15084 [-]
ProductF pilus assembly
Component typeTraU_F
UniProt IDD9Z4V5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.4e-84, Aligned region: 63..363
Protein Sequence: 364 a.a.     [Download]
>gi|302595296|ref|YP_003829011.1| F pilus assembly [Escherichia coli]
MPAPRHRSGPGTGERRSRRSLPEGGIYSDRGGKKMKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITD
ICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQICPAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLG
FSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYPLTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSL
TTILNPEAVIFANPIAQGACAADAIASAFNMPLDVLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERM
AFKLHRQGMIMETIGKNNAVCNEYPSPILPKERWRYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKN
FGYLMWRKRNCVFL
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c15084-13990 Escherichia coli plasmid pEC_B24, complete sequence
CTGCCAGCGCCTCGGCATCGATCAGGTCCCGGCACGGGTGAGCGCCGTTCCCGGCGATCGCTTCCTGAAG
GTGGAATTTATTCCGACAGAGGAGGGAAGAAAATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCT
CGCCGGTCATGTCCCTGCAGCGTCTGCGGATTCTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGAT
ATCTGCTGGAGCTGTATTTTCCCGCTCTCGCTGGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACA
CGGCGAACCCGTCGATGCCCATTCAGATTTGTCCGGCACCGCCGCCGCTGTTCAGGCGTATCGGACTGGC
CATTGGTTACTGGGAGCCGATGGCGCTGACGGACGTCACCCGGTCACCGGGATGTATGGTGAACCTGGGC
TTCAGCCTGCCGGCTTTTGGTAAAACGGCACAGGGAACGGCGAAAAAAGATGAGAAGCAGGTGAACGGGG
CGTTCTATCACGTTCACTGGTACAAATACCCGCTGACGTACTGGCTTAACATCATCACATCGCTGGGCTG
TCTGGAAGGTGGTGACCTGGATATCGCTTATCTTTCTGAAATCGACCCCACCTGGACGGACAGCAGCCTG
ACCACCATTCTCAATCCGGAAGCTGTCATCTTTGCCAATCCGATAGCACAGGGGGCCTGTGCAGCAGATG
CCATTGCCAGCGCCTTTAATATGCCTCTCGATGTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTA
CCCGTTCAATGGCTGGGTGAGTAATGAGTCCAGTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATG
GCGTTCAAGCTGCACCGTCAGGGCATGATTATGGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAAT
ATCCGTCCCCAATCCTGCCCAAAGAACGCTGGCGTTATCAGATGGTGAATATGTATCCGGACAGCGGGCA
GTGCCACCCGTTCGGGCGCAGCGTGACCCGCTGGGAAACCGGGAAAAATCCGCCCAACACAAAGAAAAAC
TTCGGCTACCTGATGTGGCGTAAACGTAACTGTGTCTTCCTGTAA
 Primer design