SecReT4
Protein ID: 302595297
T4SS name [ID]Tra_F [133]
Gene symboltraW
Locus tagpecB24_p16
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]14979..15725 [-]
ProductF pilus assembly
Component typeTraW_F
UniProt IDD9Z4V6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 9.5e-11, Aligned region: 39..68
Protein Sequence: 248 a.a.     [Download]
>gi|302595297|ref|YP_003829012.1| F pilus assembly [Escherichia coli]
MAAETPRGHSGVACCGTGGTGYHPGNPAGYCPANEGGTMRCRGLIALLIWGQSVAAADLGTWGDLWPVKE
PDMLTVIMQRLTALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYGSRLFDPSVRLAADIRDNEG
RVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEMQKALDSRIYFDQ
NGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPTEEGRK
 
Nucleotide Sequence: 747 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c15725-14979 Escherichia coli plasmid pEC_B24, complete sequence
GTGGCAGCAGAAACACCACGCGGTCATTCTGGTGTCGCCTGCTGTGGTACAGGGGGCACCGGATATCACC
CGGGAAATCCAGCAGGATATTGCCCGGCGAATGAGGGCGGAACCATGAGATGCCGGGGGCTGATTGCCCT
GCTGATATGGGGGCAGAGTGTGGCCGCCGCCGATCTTGGTACCTGGGGCGATCTGTGGCCGGTAAAGGAG
CCGGACATGCTGACGGTGATCATGCAGCGCCTGACGGCACTGGAGCAGTCCGGTGAGATGGGCCGGAAAA
TGGATGCCTTTAAGGAGCGGGTGATCCGTAACAGCCTGCGGCCCCCTGCTGTGCCCGGTATAGGACGCAC
GGAGAAATACGGCAGCCGGTTGTTTGACCCGTCCGTCAGACTGGCTGCGGATATCCGGGATAACGAAGGG
CGGGTGTTTGCCCGTCAGGGTGAAGTGATGAATCCGCTGCAGTATGTTCCTTTTAACCAGACGCTGTATT
TCATCAATGGCGATGATCCGGCGCAGGTGGCCTGGATGAAACGCCAGACGCCGCCCACACTGGAGAGCAA
AATTATCCTCGTGCAGGGCAGTATCCCGGAGATGCAGAAAGCGCTGGACAGCCGTATTTACTTTGACCAG
AACGGTGTGCTCTGCCAGCGCCTCGGCATCGATCAGGTCCCGGCACGGGTGAGCGCCGTTCCCGGCGATC
GCTTCCTGAAGGTGGAATTTATTCCGACAGAGGAGGGAAGAAAATGA
 Primer design