SecReT4
Protein ID: 302595299
T4SS name [ID]Tra_F [133]
Gene symboltraC
Locus tagpecB24_p18
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]15991..18624 [-]
ProductF pilus assembly
Component typeTraC_F
UniProt IDD9Z4V8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.2e-59, Aligned region: 39..279
AAA_10 [PF12846], Evalue: 1.7e-43, Aligned region: 481..774
DUF87 [PF01935], Evalue: 1.6e-05, Aligned region: 484..671
TrwB_AAD_bind [PF10412], Evalue: 5.5e-05, Aligned region: 481..519
Protein Sequence: 877 a.a.     [Download]
>gi|302595299|ref|YP_003829014.1| F pilus assembly [Escherichia coli]
MHVNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEA
IPINGANESIVEALDHMLRTKLPRGIPLCIHLMSSQMVGDRIEYGLREFSWSGEQAERFNAITRAYYMKA
AATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDI
VGEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIA
FLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEW
GELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHLRNFLTCLPFMAG
KGLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTS
GAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQL
SVMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQ
YTANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEG
WRLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAK
YNQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKE
GLSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c18624-15991 Escherichia coli plasmid pEC_B24, complete sequence
ATTCATGTGAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGC
CTGACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCC
GTACCGTGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCC
ATTCCCATCAATGGGGCGAATGAGTCCATTGTGGAGGCCCTCGATCACATGCTGCGCACCAAACTGCCGC
GCGGTATTCCGTTGTGTATCCATCTGATGTCCAGTCAGATGGTTGGTGACAGGATTGAATACGGGCTGCG
TGAGTTCTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCG
GCAGCGACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTTA
TCTCGTACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCCGACATTCTGGAAATGGAAAACCTGGTGAAAAT
TATCCGGGCGTCGTTACAGGGTGCCAGTATCACCACACAGACGGTGGATGCACAGGCCTTTATCGATATT
GTCGGGGAGATGATTAACCATAATCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTG
ATCTGAATTATCAGTGTGTGGAGGACAGTTTTGATCTGAAAGTCCGGGCTGATTACCTGACGCTGGGCCT
GCGTGAGAATGGCAGGAACAGTACGGCCCGCATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCC
TTCCTGTGGAACATGGCCGACAACTACAGCAACCTGCTTAATCCGGAACTGTCCATCTCCTGTCCGTTCA
TCCTGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGA
CCTGGAGAAGAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAAGCGAAGGAGTGG
GGGGAACTGCGTCAGCGGCTGGGCTCCGGTCAGTCTTCTGTCGTGTCCTACTTCCTCAATATCACAGCAT
TCTGCAAGGACAATAATGAAACGGCACTGGAAGTTGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGG
TTTTGAGCTGATTTCACCGCGCTTTAACCACCTGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGG
AAAGGGTTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTACAGCGCGCAGAGAGCTTTAATGTGGCCAACC
TGATGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCT
GGCGTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTATAACATGGCGGTCTGTGGCACCTCC
GGGGCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGGGGCTTTGCCGTGG
TGTTCGACATGGGGGATGGTTACAAGTCCCTGTGTGAGAACATGGGGGGCGTATATCTGGACGGTGAAAC
CCTGCGCTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGCGACCAGCTG
TCGGTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCAGTCAGGG
CATCATGGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGA
CAGCGAGCAGTATGCCGAGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAG
TACACTGCTAACGGCACTTATGGCCAGTATTTCAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAA
TGGTGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCCCTGCTGGTTGCGGTGATGTTCAGCCTCAT
TATTTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAAAAACTGAACGTCATTGATGAGGGA
TGGCGTCTGCTGGACTTCAAAAATCACAAGGTCGGTGAGTTTATTGAGAAAGGTTACCGTACCGCCCGCC
GTCATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGACAAGGCCTCCAGTGC
TGCCCGCGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCGAAA
TACAACCAGCTGTATCCGGACCAGTTCCTGCCACTGCAGCGTGACATGATTGGTAAGTTCGGTGCGGCCA
AAGATCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGA
CCCGTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAGCGTAAAGAG
GGGCTGAGTATTCATGAGGCGGTGTGGCAACTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGG
AAGCCTGGCTGGAAGAACATGAGAAATACAGGAGTGTGGCATGA
 Primer design