SecReT4
Protein ID: 302595301
T4SS name [ID]Tra_F [133]
Gene symboltraV
Locus tagpecB24_p20
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]19134..19649 [-]
ProductF pilus assembly
Component typeTraV_F
UniProt IDD9Z4W0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.3e-39, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|302595301|ref|YP_003829016.1| F pilus assembly [Escherichia coli]
MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCITMEQANEKAKKLEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKLRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c19649-19134 Escherichia coli plasmid pEC_B24, complete sequence
ATGAAACAGATTTCTTTATTTATTCCTCTGCTGGGGACCTTATTACTTTCCGGCTGTGCCGGAACCAGTA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATTACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCTCGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACTACGTATTAATTAA
 Primer design