SecReT4
Protein ID: 302595305
T4SS name [ID]Tra_F [133]
Gene symboltraB
Locus tagpecB24_p24
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]20771..22201 [-]
ProductF pilus assembly
Component typeTraB_F
UniProt IDD9Z4W4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.8e-40, Aligned region: 214..410
CALCOCO1 [PF07888], Evalue: 4.7e-05, Aligned region: 69..122
Protein Sequence: 476 a.a.     [Download]
>gi|302595305|ref|YP_003829020.1| F pilus assembly [Escherichia coli]
MMASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQH
ATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMP
ASPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNQIQRKVFTRNEGKQGP
SLPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERA
IVRTRNISCLKNGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGL
GATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALER
TQNRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c22201-20771 Escherichia coli plasmid pEC_B24, complete sequence
CTGATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTA
CAGCCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGC
TGAACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCAT
GCCACCACCGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGG
ATGTTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGTTGGGACAGGACAATGCCGCCCT
GGCAGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCT
GCCTCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCA
GCGTTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTA
CCAGTCTGTGCCGGTGCCTAACCAGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCA
TCGCTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCT
CAGTCACCGGTAATGAATCCACGGTGCCGATGCAGCTGCGTATCACCGGTCTGGTGGAAATGCCGAACAG
CAAGACGTATGACGCAACGGGATGTTTTGTGGGGCTGGAAGCCTGGGGGGATGTCTCCAGTGAACGTGCG
ATTGTTCGCACCCGTAATATCAGCTGCCTGAAGAATGGCAAAACCATTGATATGCCGATTAAGGGGCATG
TCAGCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGC
ATGGGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAGCCGGCTGTCGGGCTG
GGTGCCACAGCCGCTTACGGGGCCGGCGATGTCCTTAAAATGGGGATTGGTGGCGGTGCATCGAAAGCCG
CACAGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGG
CAACGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACTGTAGAAGAGATGGCACTGGAGCGC
ACGCAGAACAGAGCAGAAGAAGACAATCCGGAAAGTCCGGTTCCTGTTCCGCCATCAGCTGAAAGTCATC
TTAACGGCTTTAATACTGACCAGATGCTGAAGCAGCTGGGCAACCTGAATCCGCAGCAGTTTATGTCCGG
CAGCCAGGGAGGGGGCAACGATGGCAAATAA
 Primer design