SecReT4
Protein ID: 302595306
T4SS name [ID]Tra_F [133]
Gene symboltraK
Locus tagpecB24_p25
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]22198..22947 [-]
ProductF pilus assembly
Component typeTraK_F
UniProt IDD9Z4W5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.3e-69, Aligned region: 19..242
Protein Sequence: 249 a.a.     [Download]
>gi|302595306|ref|YP_003829021.1| F pilus assembly [Escherichia coli]
MISGKQTMRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNS
LDGALTNNEQTASGGVVVATVNKKPFTFILETKRGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWET
STPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNI
RESDFWQPGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 750 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c22947-22198 Escherichia coli plasmid pEC_B24, complete sequence
ATAATTTCGGGGAAACAGACGATGAGAAAAAATAATACGGCAATAATATTCGGCAGCCTGTTTTTTTCCT
GCAGCGTGATGGCCGCAAACGGTACGCTGGCCCCCACCGTGGTGCCAATGGTGAACGGTGGTCAGGCCAG
TATTGCCATCAGCAATACCAGCCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGT
CTGGATGGTGCCCTGACCAATAATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAA
AGCCCTTTACGTTCATTCTGGAAACAAAACGTGGTCTGAATCTTTCCATTCAGGCCGTTCCCCGTGAAGG
CGCGGGGCGTACCATTCAGCTGGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGTGCGTGGGAAACG
TCCACGCCTTACGAATCCCTGCTTGTGACCATCAGCCAGGCCGTCCGTGGCGGAAAATTACCCGCAGGCT
GGTATCAGGTCCCAGTGACAAAGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATGCCGT
ATGGACGGGGAATCACCTGAAGATGGTCCGCTTTGCCGTGGAAAATAAAACGCTGTCTGCCCTGAATATC
CGGGAAAGTGACTTCTGGCAGCCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGG
CAGGTGCGCGCATGGATGTGTATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design