SecReT4
Protein ID: 302595337
T4SS name [ID]Tra_F [133]
Gene symboltraI
Locus tagpecB24_p72
StrainEscherichia coli plasmid pEC_B24 (NC_014382)
Repliconplasmid pEC_B24 [GenBank: NC_014382] [Browse all T4SS(s) in this replicon]
Location [Strand]68528..73801 [-]
Producttype IV secretion-like conjugative transfer relaxase protein
Component typeTraI_F
UniProt IDD9Z4Z6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.2e-87, Aligned region: 8..288
TraI [PF07057], Evalue: 1.6e-58, Aligned region: 1435..1561
AAA_30 [PF13604], Evalue: 6.7e-42, Aligned region: 969..1157
AAA_19 [PF13245], Evalue: 1.1e-05, Aligned region: 983..1048
UvrD_C_2 [PF13538], Evalue: 3.5e-05, Aligned region: 1342..1445
Protein Sequence: 1757 a.a.     [Download]
>gi|302595337|ref|YP_003829052.1| type IV secretion-like conjugative transfer relaxase protein [Escherichia coli]
MMMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRM
QDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNL
VMALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVE
ALGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQ
TLKETGFDIRAYRDAADQRAETRTQAPGAVSQEGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPP
ENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGY
SDAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITG
RRQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYR
WQGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGLPEV
TMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLD
SSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFTALK
LENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQ
IKARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTSFIDLGGEIN
AQIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRM
ILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHD
TQLLQRSGETPNFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRS
AADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAE
AQQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQV
MVPVLNTANIRDGELRRLSTWETHRDVLVLVDNVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGV
TLYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAGQHIDLAYA
ITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDDRQGWTDAINNAVQKGTAHDV
FEPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSA
GIWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAG
EGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDL
PDGKTELAVREIAGQERDRAAITEREAALPESVLREPQREREAVREVARENLLQERLQQMERDMVRDLQK
EKTLGGD
 
Nucleotide Sequence: 5274 bp     [Download]
>gi|302595284|ref|NC_014382.1|:c73801-68528 Escherichia coli plasmid pEC_B24, complete sequence
CTGATGATGAGTATCGCGCAGGTCAGATCGGCCGGAAGTGCCGGTAACTATTATACCGACAAGGATAATT
ACTATGTACTGGGCAGCATGGGAGAACGCTGGGCCGGCAGGGGGGCTGAACAGCTGGGACTGCAGGGCAG
TGTCGATAAGGATGTTTTTACCCGTCTTCTGGAGGGAAGGCTGCCGGACGGAGCGGATCTAAGCCGCATG
CAGGATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGA
TGGCCATGTTAGGTGGCGATAAGCGCCTGATTGATGCACATAACCAGGCCGTGGACTTTGCTGTTCGTCA
GGTGGAGGCGCTGGCCTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTACTGACCGGTAATCTG
GTGATGGCACTGTTTAACCACGACACCAGTCGCGATCAGGAACCACAGTTACACACGCATGCGGTGGTGG
CTAATGTCACGCAGCATAACGGTGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACGGGGTTCAT
TGAGAATGTGTACGCTAATCAGATTGCCTTTGGCAGGCTCTACCGGGAAAAACTGAAAGAGCAGGTTGAG
GCGCTGGGCTATGAAACTGAAGTGGTCGGTAAGCACGGTATGTGGGAAATGCCGGGCGTACCGGTGGAGG
CCTTTTCCGGACGCTCACAGGCAATCCGGGAGGCCGTCGGGGAAGATGCCTCGCTGAAATCCCGGGATGT
GGCGGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAG
ACGCTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGACCCGCA
CGCAGGCGCCCGGGGCTGTTTCACAGGAGGGGCCGGATGTGCAGCAGGCGGTGACACAGGCCATTGCCGG
ATTAAGTGAACGAAAAGTGCAGTTTACGTACACGGACGTGCTGGCCAGAACGGTCGGCATACTGCCGCCG
GAAAATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCC
TCGATCGTGAGAAGGGGCTGTTCACGTCCGGGATTCATGTGCTCGATGAGCTGTCAGTCCGGGCACTCAG
TCGTGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCCGGTTAC
AGCGATGCGGTCAGTGTTCTGGCACAGGACCGTCCGTCGCTGGCTATTGTGTCCGGGCAGGGCGGTGCAG
CCGGGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTAT
CGCTGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGTTGTCCGGTGAGCTGATAACCGGA
CGTCGTCAGCTGCTGGAAGGCATGGCCTTCACGCCGGGCAGTACTGTTATCGTTGACCAGGGCGAAAAAC
TCTCCCTGAAAGAGACGTTAACCCTGCTGGACGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGA
CAGCGGGCAGCGAACCGGTACAGGCAGTGCACTGATGGCCATGAAGGATGCCGGGGTGAACACATATCGC
TGGCAGGGGGGAGAACAGCGACCGGCCACCATCATCAGTGAACCGGACCGTAATGTCCGCTATGCCCGGC
TGGCAGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGA
ACAGGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACTCCCGGAGGTG
ACCATGACTGCCCTTTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGTCCGG
GGATGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTTATCGACCGGGTGACGGC
GCAGAGTCACAGCCTGACCCTGCGGGATGCGCAGGGTGAAACGCAGGTGGTGCGTATTTCCTCCCTGGAC
AGCAGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGA
AAATTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGAC
GGTTGTTGTGCCGGGGCGGGCTGAACCGGCCTCCCTGCCTGTGAGCGATTCACCATTCACGGCACTGAAG
CTGGAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGCGACAGTGCGAAGGTTTTTGCCTCCGTCA
CACAGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCGTGATGTCCGGCTGTATTC
TTCACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAG
ATAAAGGCGCGTGCCGGTGAGACATTGCTGGAAACCGCTATCAGTCTGCAGAAAGCCGGGCTTCACACGC
CGGCACAGCAGGCTATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGA
CCTGCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCAGTTTTATCGACCTGGGAGGGGAAATCAAT
GCGCAGATAAAACGCGGTGATTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGGTTT
CCCGTGCGTCGTATGAGGCAGAAAAGAGCATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCC
GCTGATGGAGAGAGTACCTGGCGAACTCATGGAGAAACTGACATCAGGACAGCGTGCCGCCACCCGCATG
ATACTGGAAACGTCCGACCGTTTCACGGTGGTGCAGGGCTATGCCGGTGTGGGTAAGACCACACAGTTCC
GGGCGGTGATGTCAGCCGTGAACATGCTGCCGGAGAGTGAACGTCCCCGTGTCGTGGGGCTGGGGCCCAC
GCACCGTGCGGTCGGTGAGATGCGCAGCGCCGGCGTGGATGCACAGACGCTGGCGTCCTTTCTGCATGAC
ACGCAGCTGCTGCAGCGCAGCGGAGAAACGCCGAATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCT
CTATGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGAGCTGTGGC
CAGTGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGT
GCTGCTGATGTGGCCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCC
TGATTAACCGGGATGTGGAAAGGGCGCTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTGCCACGTCT
GGAGGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAA
GCGCAGCAGAAGGCGATGCTGAAAGGCGAGGCTTTTCCTGATGTCCCCATGACACTGTATGAAGCCATTG
TCCGCGACTATACCGGCAGAACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAAGA
CAGGCGCGTACTGAACAGTATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTC
ATGGTGCCTGTCCTGAACACAGCGAATATACGTGACGGAGAACTGCGTCGTCTTTCCACCTGGGAGACTC
ATCGGGACGTACTTGTCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGTAAGGATGACGGGCT
GATAACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGCGTC
ACACTGTACACTCCGGACACCATCCGGGTGGGAACCGGTGACCGGATGCGCTTCACGAAGAGTGACCGGG
AGCGCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGCTGTCGGA
CGGCCAGCAGACCCGGGTGATTCGCCCCGGCCAGGAACGGGCAGGGCAACATATTGACCTGGCCTATGCC
ATCACCGCCCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTGAAGGCACGGAAGGTAACC
GGAAACTGATGGCCGGCTTTGAGTCAGCCTACGTTGCCCTGTCGCGTATGAAGCAGCATGTACAGGTGTA
CACCGATGACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACTGCCCACGATGTG
TTTGAGCCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTACGGCACGGGAACTGCGGG
ACGTGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCGGGGCTGGCCGGGGGAGACAGTCCTGCACGGTTTAT
TGCTCCGGGACGTAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAAGTCCGCC
GGTATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGTGGTGAAGGACGGG
TGAAGGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGCAGCCGTAACGGAGAAAGCCTGCTGGCTGA
TAATATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTGAGAATTGCCGGT
GAAGGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGCCGCGTGTGGGGGGATATCCCGGACAACAGCG
TCCAGCCGGGTGCCGGAAATGGCGAACCGGTCACGGCAGAGGTACTGGCACAGCGGCAGGCTGAAGAGGC
TATCCGCCGTGAAACGGAACGCCGCGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTG
CCGGATGGCAAAACAGAGCTGGCTGTCAGGGAAATTGCCGGGCAGGAGCGTGACCGGGCTGCCATAACTG
AACGGGAAGCCGCGCTGCCGGAGAGTGTACTGCGTGAACCACAACGGGAACGGGAAGCGGTCCGCGAGGT
TGCCCGGGAAAACCTGCTGCAGGAGCGTCTGCAGCAGATGGAGCGGGATATGGTTCGTGACCTGCAGAAA
GAGAAAACCCTGGGCGGAGACTGA
 Primer design