SecReT4
Protein ID: 302595398
T4SS name [ID]Tra_F [128]
Gene symboltraL
Locus tagpECL46p067
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]57194..57508 [+]
ProductF pilin assembly
Component typeTraL_F
UniProt IDQ7B3W7, D9Z579
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.4e-37, Aligned region: 10..104
Protein Sequence: 104 a.a.     [Download]
>gi|302595398|ref|YP_003829260.1| F pilin assembly [Escherichia coli]
MMSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRG
SSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 315 bp     [Download]
>gi|302595338|ref|NC_014385.1|:57194-57508 Escherichia coli plasmid pEC_L46, complete sequence
ATGATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCT
GGTTTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAA
ATATCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGC
AGTTCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATG
TTCCCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design