SecReT4
Protein ID: 302595414
T4SS name [ID]Tra_F [128]
Gene symboltraQ
Locus tagpECL46p086
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]71307..71591 [+]
Productconjugal transfer protein
Component typeTraQ_F
UniProt IDD9Z595
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.5e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|302595414|ref|YP_003829276.1| conjugal transfer protein [Escherichia coli]
MISKCRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|302595338|ref|NC_014385.1|:71307-71591 Escherichia coli plasmid pEC_L46, complete sequence
ATGATAAGTAAATGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCTCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAGCAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design