SecReT4
Protein ID: 302595430
T4SS name [ID]Trw [152]
Gene symboltraL
Locus tagpECL46p103
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]90716..91453 [+]
Productconjugal transfer protein
Component typeTrwN
UniProt IDD9Z5N6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.7e-33, Aligned region: 31..177
Protein Sequence: 245 a.a.     [Download]
>gi|302595430|ref|YP_003829292.1| conjugal transfer protein [Escherichia coli]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGGSTQL
KQQPRTEAEAVSVSKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKS
YPAGQVALRHALSCYNTGSLINGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTATEPQQAKSTAT
QYDGEQDVFGSGDGDAFSRNNTDAFLTKQETAKGE
 
Nucleotide Sequence: 738 bp     [Download]
>gi|302595338|ref|NC_014385.1|:90716-91453 Escherichia coli plasmid pEC_L46, complete sequence
ATGAGTAAACATCCAAAACTTCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCAGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACAATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGGCCGTACAGGATCAATATTAACGGTGGTAGTACCCAGTTA
AAACAGCAACCACGTACTGAAGCTGAGGCCGTCAGCGTTTCGAAAGTTCTGCTGAAGGATAATAAAAGTT
TTGATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTT
CAAGCCCTGCATCAACCTGCGGGCGAGCCAGACCATCCTTAAAGCCTGTTATGATAGCGCCCTGAAATCC
TATCCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCATAAACGGGA
TTTCTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCT
GCTACCTGATGGCCAGACCAGTGAGGACAGCACCGCGACTGAGCCTCAGCAGGCAAAAAGTACGGCCACG
CAGTATGACGGTGAACAAGATGTTTTTGGTTCGGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATG
CCTTTTTAACCAAACAGGAAACAGCGAAGGGGGAGTGA
 Primer design