SecReT4
Protein ID: 302595432
T4SS name [ID]Trw [152]
Gene symboltraM
Locus tagpECL46p105
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]91753..92046 [+]
Productconjugal transfer protein
Component typeTrwL
UniProt IDD9Z5N8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|302595432|ref|YP_003829294.1| conjugal transfer protein [Escherichia coli]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASFLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|302595338|ref|NC_014385.1|:91753-92046 Escherichia coli plasmid pEC_L46, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCGCTGATTGGTATTGGTTCTGCATCATTTCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design