SecReT4
Protein ID: 302595435
T4SS name [ID]Trw [152]
Gene symboltraC
Locus tagpECL46p108
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]94980..95744 [+]
Producthypothetical protein
Component typeTrwJ
UniProt IDD9Z5P1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.1e-49, Aligned region: 42..233
CENP-Q [PF13094], Evalue: 3.8e-06, Aligned region: 50..154
Protein Sequence: 254 a.a.     [Download]
>gi|302595435|ref|YP_003829297.1| hypothetical protein pECL46p108 [Escherichia coli]
MAQRILAPDGLTTRQNTMKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKS
QLQTQKNMYESMAKTTNLGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMT
PSEAITYMNKKLAEKGAYDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGE
QAKLNLMNMLQQSQDKLLRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 765 bp     [Download]
>gi|302595338|ref|NC_014385.1|:94980-95744 Escherichia coli plasmid pEC_L46, complete sequence
ATGGCTCAAAGAATACTGGCGCCTGACGGCTTAACAACGAGGCAAAACACCATGAAAAAAACACTGACGG
CAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCGCAGGCATCATCGTGACCAA
CCCTACTGAACTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCAGCTGGAGCAGCTTAAAAGC
CAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAACCTGGGCGATCTGCTGGGGA
CGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATTTACAGCGACGCCATGAACTC
CAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGCGGAAGTTGACGACATGACG
CCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCTTATGACCGCGTTATGGCAG
AAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGACGGAGCAGATTAAAACGAC
TCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACAGGGTGCTATTCAGGGTGAG
CAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTATTACGTGCGCAGAAAGAAC
GTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCACCTTCAATTAACTGA
 Primer design