SecReT4
Protein ID: 302595438
T4SS name [ID]Trw [152]
Gene symboltraN
Locus tagpECL46p111
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]97103..97264 [+]
Productconjugal transfer protein
Component typeTrwH
UniProt IDD9Z5P4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 53 a.a.     [Download]
>gi|302595438|ref|YP_003829300.1| conjugal transfer protein [Escherichia coli]
MMDAVMRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 162 bp     [Download]
>gi|302595338|ref|NC_014385.1|:97103-97264 Escherichia coli plasmid pEC_L46, complete sequence
ATAATGGATGCCGTAATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGC
ATAAACCGCCACCGGAGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCA
AGGTGGTGCAAATGAAAGCTAA
 Primer design