SecReT4
Protein ID: 302595439
T4SS name [ID]Trw [152]
Gene symboltraE
Locus tagpECL46p112
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]97233..97952 [+]
Productconjugal transfer protein
Component typeTrwG
UniProt IDD9Z5P5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.9e-53, Aligned region: 31..237
Protein Sequence: 239 a.a.     [Download]
>gi|302595439|ref|YP_003829301.1| conjugal transfer protein [Escherichia coli]
MIRKVVQMKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHK
YSQPIPAHLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNV
AESYQSKFKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEY
KSLAMNAEQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 720 bp     [Download]
>gi|302595338|ref|NC_014385.1|:97233-97952 Escherichia coli plasmid pEC_L46, complete sequence
TTGATACGCAAGGTGGTGCAAATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGT
TCAACGAAAGCCGTAAAGGGCTTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTG
GATGGTTGCCACCGGTTCAGCGGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTGGTGCATAAG
TACAGCCAGCCAATCCCCGCACATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGC
TGACCCGCGACCAGACCTCTTATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCG
TGAGAGCTATGACTTCTATTCAGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTG
GCAGAGTCTTACCAGAGCAAGTTCAAGGGCCGCAACGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGA
CCCGCGTGAAGATTAACTCTGTGATCCTCGATAAACCGCACGGCGTAGCAACGATACGCTTTACTACGGT
TCGCCGCGTGCGCAGCAATCCCGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATAT
AAATCGCTGGCGATGAATGCTGAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCG
TCAACCCGGAAGTTAACTGA
 Primer design