SecReT4
Protein ID: 302595440
T4SS name [ID]Trw [152]
Gene symboltraO
Locus tagpECL46p113
StrainEscherichia coli plasmid pEC_L46 (NC_014385)
Repliconplasmid pEC_L46 [GenBank: NC_014385] [Browse all T4SS(s) in this replicon]
Location [Strand]97927..98847 [+]
Producttype IV conjugative transfer system protein
Component typeTrwF
UniProt IDD9Z5P6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.2e-57, Aligned region: 45..279
Protein Sequence: 306 a.a.     [Download]
>gi|302595440|ref|YP_003829302.1| type IV conjugative transfer system protein [Escherichia coli]
MASTRKLTEGCPMKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAIAGVATH
IVVAPDETYITHAFGDSESWTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTV
SKSFIETPWAVRQAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPV
HVWDNYRFTRFEFPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNN
FAPGAGAVATGTASPDVRRVQIGEDN
 
Nucleotide Sequence: 921 bp     [Download]
>gi|302595338|ref|NC_014385.1|:97927-98847 Escherichia coli plasmid pEC_L46, complete sequence
ATCGCGTCAACCCGGAAGTTAACTGAGGGCTGCCCCATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGT
CAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGCTTGAGGTTGGCCGCAATTCTCCTTATGACTATCG
CATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGTCAAAATTGACGCTATCGCCGGTGTGGCTACCCAC
ATTGTTGTCGCGCCTGACGAAACCTATATCACTCATGCTTTTGGCGATTCTGAAAGCTGGACGTTTGCGC
ACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGGCCATGAGTGATACCAACCTGGTGATCGTCACCGA
TAAGCGCACCTATAACATCGTCCTCCATTTCATCGGTGAAGAAACGAAGAAAAATGCAGACGGTACGGTA
TCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGCCAGGCCGTTCTTCAGCTGACCTATGAATATCCGT
TTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATAAAAAACGCATTACGCAGAAGCTGAAGCAGACGGC
TTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAGCGAACAGCCTGAAATGCGCAGCATCCAGCCGGTT
CACGTCTGGGATAACTACCGCTTTACCCGGTTTGAGTTTCCGGCCAATGCGGAGTTACCGCAGGTCTACA
TGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACTCTCATGTTGTGGGTGAGAACCGCAACATCATCGA
GGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCTGGGCGATAAAGTCGTTGGCGTTCGTAATAATAAT
TTCGCGCCGGGCGCCGGTGCGGTAGCAACCGGTACGGCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGG
AGGATAACTGA
 Primer design